(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE2

MICSR_1.PE2          Location/Qualifiers
FT   CDS             complement(2196..3374)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636007"
FT                   /orf_name="MICPUN_107844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62029.1"
FT                   /db_xref="UniParc:UPI000199A9EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M9"
FT                   /transl_table=1
FT                   /translation="MVDSGNQWKTRGYLPGVNTWGSRVDTWRVKDFVTTVETSLREAAS
FT                   SVFARCQYGQVGESLKQLASVCSGLSFAERTKILDAASKLLNNLTAFNGTDMTLGNAGD
FT                   TNLQPDANSTDGDASYSVDTAIVRVPTDNETLAAACMGTVVSNSADSSVAPVTSRRRTS
FT                   RRRLSQAEADAATLQDAGCWSRVRNSNDALVGMLLGECIQVSLGAGQQLLDGVKACLKT
FT                   KPDRAINVDYTQDIFVKRTTVNGVEKYTPMSTITVERVGTQICGKVTDVGSFFCPARVA
FT                   PNWATATTDIGSTECPIVDVIGAAKLAAIETIRNRNKASGEKDGPLPGLDQASGIAVLA
FT                   VMCLFICGCCVGCRWLVVRRRRRQQAAAGKAMVVHNTLIHSQTQVVQSTAQP"
     MVDSGNQWKT RGYLPGVNTW GSRVDTWRVK DFVTTVETSL REAASSVFAR CQYGQVGESL        60
     KQLASVCSGL SFAERTKILD AASKLLNNLT AFNGTDMTLG NAGDTNLQPD ANSTDGDASY       120
     SVDTAIVRVP TDNETLAAAC MGTVVSNSAD SSVAPVTSRR RTSRRRLSQA EADAATLQDA       180
     GCWSRVRNSN DALVGMLLGE CIQVSLGAGQ QLLDGVKACL KTKPDRAINV DYTQDIFVKR       240
     TTVNGVEKYT PMSTITVERV GTQICGKVTD VGSFFCPARV APNWATATTD IGSTECPIVD       300
     VIGAAKLAAI ETIRNRNKAS GEKDGPLPGL DQASGIAVLA VMCLFICGCC VGCRWLVVRR       360
     RRRQQAAAGK AMVVHNTLIH SQTQVVQSTA QP                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page