(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE20

MICSR_1.PE20         Location/Qualifiers
FT   CDS             36845..38251
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636025"
FT                   /orf_name="MICPUN_56591"
FT                   /product="Predicted protein"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO61594.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG560051"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI000199AAB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P7"
FT                   /transl_table=1
FT                   /translation="MADQAGQKKPYDYQERYRHVRQKPLSVYSVEVKGDERTRPGLFAR
FT                   VLDPVYRASTLDELRVRCVEANAVLNSYDIFDRVDIEMDAGPREHPDSAKVTVEVSEKK
FT                   KLNLKGGAYVSQQGEGSMEVSVGLNNALGYAEKLDVEFIKGHERSNSCTLAWNQPRVGN
FT                   VDVDVVTRAFQQVSCSKRLSSFDETARGISVTAVGGGPATVDYSLVWREIADPTRLASK
FT                   SIRQQLGHSLKSSVSYTYQVDERDRPVRPGAGYLARVRSELAGVGWDPQMTRFLKHEAE
FT                   VQAAHTPAEGVTFFASAKLGAMMPLGQNAKDPEKGTCIADRFFLGGVGSLRGFEPHGAG
FT                   PSDERRPPPTKAAASGENLITRDALGGDVLAQLFASYQLEPEWSKLRDIGVYGHFFVNA
FT                   GTLMPWITGERKRVSGRELADSFRASVGVGLVFPLPVGNIEVNYCHTLRSRPGDRVKNG
FT                   LQIGLATALA"
     MADQAGQKKP YDYQERYRHV RQKPLSVYSV EVKGDERTRP GLFARVLDPV YRASTLDELR        60
     VRCVEANAVL NSYDIFDRVD IEMDAGPREH PDSAKVTVEV SEKKKLNLKG GAYVSQQGEG       120
     SMEVSVGLNN ALGYAEKLDV EFIKGHERSN SCTLAWNQPR VGNVDVDVVT RAFQQVSCSK       180
     RLSSFDETAR GISVTAVGGG PATVDYSLVW REIADPTRLA SKSIRQQLGH SLKSSVSYTY       240
     QVDERDRPVR PGAGYLARVR SELAGVGWDP QMTRFLKHEA EVQAAHTPAE GVTFFASAKL       300
     GAMMPLGQNA KDPEKGTCIA DRFFLGGVGS LRGFEPHGAG PSDERRPPPT KAAASGENLI       360
     TRDALGGDVL AQLFASYQLE PEWSKLRDIG VYGHFFVNAG TLMPWITGER KRVSGRELAD       420
     SFRASVGVGL VFPLPVGNIE VNYCHTLRSR PGDRVKNGLQ IGLATALA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page