(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE200

MICSR_1.PE200        Location/Qualifiers
FT   CDS             405419..407098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636540"
FT                   /orf_name="MICPUN_56773"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61691.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AA58"
FT                   /db_xref="UniProtKB/TrEMBL:C1E177"
FT                   /transl_table=1
FT                   /translation="MATSATPAGLRAPSAGRARSSRTRILAISRATSATATSQDVIARG
FT                   SARRVQIPVVDLSEPDAVCASIVRTACDSCGFFHVVNHGVDDNLAFDVIRWGATFFDRP
FT                   WDDKMALVRGDMRVSRGYEISPEHIEALDRDVTREEELAAREPSAARRIISERFSVGPF
FT                   DVPNDSYHTDEEGALFFHPNAWPEDSIPSLRPAMEAYYREMESLCARLHRVLALAMGAP
FT                   ADFFEDKIDKHCSNLQVANYPSLDPSRWRDSDRIPLRKKSHADSGTLTVLWRSPPTEGT
FT                   KGGLQVLDDTAGTWVDVPVLPGGNERESGALLINLGNQTQRWTDGKWVSTKHRVTNPDV
FT                   HAPGYAPSRRLSVAFFHKANYDAVIDHRDFVPGRERDAPSVSYPPVRSGDVSRVGALRR
FT                   LGRGVDAREASMRYHEELMGGRDRAERAAGESTAVKIDASAETEGEPPKKGEPPKKAEP
FT                   EADRWASLMDPRGQAGPISAGDLGLDRGASAEGAGAGNDNPAAGCPVCRGTGWKPCGQC
FT                   GGTGINREDLFGGKFKEGDTCWLCSGKKKTMCGNCVDLTDSF"
     MATSATPAGL RAPSAGRARS SRTRILAISR ATSATATSQD VIARGSARRV QIPVVDLSEP        60
     DAVCASIVRT ACDSCGFFHV VNHGVDDNLA FDVIRWGATF FDRPWDDKMA LVRGDMRVSR       120
     GYEISPEHIE ALDRDVTREE ELAAREPSAA RRIISERFSV GPFDVPNDSY HTDEEGALFF       180
     HPNAWPEDSI PSLRPAMEAY YREMESLCAR LHRVLALAMG APADFFEDKI DKHCSNLQVA       240
     NYPSLDPSRW RDSDRIPLRK KSHADSGTLT VLWRSPPTEG TKGGLQVLDD TAGTWVDVPV       300
     LPGGNERESG ALLINLGNQT QRWTDGKWVS TKHRVTNPDV HAPGYAPSRR LSVAFFHKAN       360
     YDAVIDHRDF VPGRERDAPS VSYPPVRSGD VSRVGALRRL GRGVDAREAS MRYHEELMGG       420
     RDRAERAAGE STAVKIDASA ETEGEPPKKG EPPKKAEPEA DRWASLMDPR GQAGPISAGD       480
     LGLDRGASAE GAGAGNDNPA AGCPVCRGTG WKPCGQCGGT GINREDLFGG KFKEGDTCWL       540
     CSGKKKTMCG NCVDLTDSF                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page