(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE202

MICSR_1.PE202        Location/Qualifiers
FT   CDS             join(408660..408788,408884..410521)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636542"
FT                   /orf_name="MICPUN_56775"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61692.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E179"
FT                   /transl_table=1
FT                   /translation="MGKIPDTAAARKALKVAEIKALLEEAGLATDGTKPTLLERLEEHV
FT                   AKTDGDDGAEVAAPAAEPAPAPAAEPEAAAPEAAPEPVRDVPPPPVREVPPPPPAPAVA
FT                   KDDAKHEEDEEDGGEKWVLVAPAPTPLESLREMCAGCVSVEPLGGGPADGASTMALVEF
FT                   PAERDALNAVAALAALGHEAEIARRTLWQDDEDDADVTSTIVRVEGVSATIHESIVASV
FT                   FGTYGTCIAATREEGTDAFAVRMADRRGAETATAALSGVYRFEEGQEFPVRVTWCPCPS
FT                   KKSGGDRSSAAGEKRKRDEDVANGEGATLSAKQLLAVGLPATTQSGEQVAGWFAAEGGA
FT                   CTLFDKDRRCAILAFPTADAATEALDTHGGTLRPEGNPCPVTLRRIACDLDARPKKRSA
FT                   VQGPPPGVWPPVPKPGPEYGEPSAKIYIGSIPQEYAEDDVRRIFSTVGEVREVKILRNP
FT                   GDGRHKGSGFVTFSDIAATERAIHFIDNKYTLIAPAHPLQKPIYMKYAKIGRPSAAPQQ
FT                   PMVYQQPMAYQQPYYPPQQAYGHYPQHPQQAYAQYPQQAYGQYPQQGQAPQGPTHQQQQ
FT                   MWQQGFGGGAQQ"
     MGKIPDTAAA RKALKVAEIK ALLEEAGLAT DGTKPTLLER LEEHVAKTDG DDGAEVAAPA        60
     AEPAPAPAAE PEAAAPEAAP EPVRDVPPPP VREVPPPPPA PAVAKDDAKH EEDEEDGGEK       120
     WVLVAPAPTP LESLREMCAG CVSVEPLGGG PADGASTMAL VEFPAERDAL NAVAALAALG       180
     HEAEIARRTL WQDDEDDADV TSTIVRVEGV SATIHESIVA SVFGTYGTCI AATREEGTDA       240
     FAVRMADRRG AETATAALSG VYRFEEGQEF PVRVTWCPCP SKKSGGDRSS AAGEKRKRDE       300
     DVANGEGATL SAKQLLAVGL PATTQSGEQV AGWFAAEGGA CTLFDKDRRC AILAFPTADA       360
     ATEALDTHGG TLRPEGNPCP VTLRRIACDL DARPKKRSAV QGPPPGVWPP VPKPGPEYGE       420
     PSAKIYIGSI PQEYAEDDVR RIFSTVGEVR EVKILRNPGD GRHKGSGFVT FSDIAATERA       480
     IHFIDNKYTL IAPAHPLQKP IYMKYAKIGR PSAAPQQPMV YQQPMAYQQP YYPPQQAYGH       540
     YPQHPQQAYA QYPQQAYGQY PQQGQAPQGP THQQQQMWQQ GFGGGAQQ                    588
//

If you have problems or comments...

PBIL Back to PBIL home page