(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE203

MICSR_1.PE203        Location/Qualifiers
FT   CDS             join(complement(411957..412022),complement(411640..411669),
FT                   complement(410691..411245))
FT                   /codon_start=1
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636543"
FT                   /orf_name="MICPUN_56776"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62123.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E180"
FT                   /transl_table=1
FT                   /translation="MPRGKKKEPEPEPEENEVMEDAAVEDDDEESAELEEMKKRLAAME
FT                   EEAQKLKDEANAIGDDMNTGDGASGAADADRAEADSRSVHVGGVDYATTPEELAKHFEA
FT                   CGTVNRVTILTDKYDNPKGFAYVEFLEADAVQNAIKLTDTEIHGRKLRVSAKRTNVPGM
FT                   KQGGRGRGGRGGRGFNPYGMMMMPMMMPHMFGGRGRGRGRGGRGGRGGRGAPY"
     MPRGKKKEPE PEPEENEVME DAAVEDDDEE SAELEEMKKR LAAMEEEAQK LKDEANAIGD        60
     DMNTGDGASG AADADRAEAD SRSVHVGGVD YATTPEELAK HFEACGTVNR VTILTDKYDN       120
     PKGFAYVEFL EADAVQNAIK LTDTEIHGRK LRVSAKRTNV PGMKQGGRGR GGRGGRGFNP       180
     YGMMMMPMMM PHMFGGRGRG RGRGGRGGRG GRGAPY                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page