(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE204

MICSR_1.PE204        Location/Qualifiers
FT   CDS             complement(412297..413073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636544"
FT                   /orf_name="MICPUN_56777"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62124.1"
FT                   /db_xref="UniParc:UPI000199AA5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E181"
FT                   /transl_table=1
FT                   /translation="MTLLTANSSIASRVRAPRASVRSRASSLRESLSGGWNIRRIVRAD
FT                   IAARDRRGGRVATAVRAADDGNFLDKLNPFKAMEKAKEKNAIAKREKEANQVINDDMRK
FT                   QLFGDGLGGRMLQGMVNNVAGALKEQMGAAAAASQETYDAAERAVRSDPKMRAALGDGI
FT                   RCTPPMSQMSSSQNVNGVQTQATTIVFIAQGSNGRQAQVQATGTGGGDQELRLDISGML
FT                   DTGEVVKVDGMGGGSMADGVFDVEAKTIDDDDVIDV"
     MTLLTANSSI ASRVRAPRAS VRSRASSLRE SLSGGWNIRR IVRADIAARD RRGGRVATAV        60
     RAADDGNFLD KLNPFKAMEK AKEKNAIAKR EKEANQVIND DMRKQLFGDG LGGRMLQGMV       120
     NNVAGALKEQ MGAAAAASQE TYDAAERAVR SDPKMRAALG DGIRCTPPMS QMSSSQNVNG       180
     VQTQATTIVF IAQGSNGRQA QVQATGTGGG DQELRLDISG MLDTGEVVKV DGMGGGSMAD       240
     GVFDVEAKTI DDDDVIDV                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page