(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE205

MICSR_1.PE205        Location/Qualifiers
FT   CDS             413551..416436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636545"
FT                   /orf_name="MICPUN_56778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61693.1"
FT                   /db_xref="UniParc:UPI000199AA5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E182"
FT                   /transl_table=1
FT                   /translation="MEEAIAAAEATLEALVKAAEDFAVPLIAEQRAVLAAADAKAADAA
FT                   SPARDAFETVRAEFEKKIDELDGALTSAVEKERAEIAVVARAAREDPFAEDEDADVATI
FT                   VASVFDPAREHLGERLRNSRSAAEKMLQWLERRAPDLDRAATDAASKAADAGDGIDDDS
FT                   GKHEDWAADEESDLEDLPPLGGDWAEDDEDDLPPLEGEWQKDAEAGPSPTPPSPKKKPA
FT                   AFKPRDASPPRGNAWGHAPPAHGRDRSDAGHRMGPAAGRDVDLRDRLGGGGSRDYGGDR
FT                   RSSFDRGGDYGRDRGGGGFRDSWGAPGGGYRDDRRGGGGGGGGHRSEYIERMERKYGRV
FT                   DDGPPPRSTMRDRSPPKPPPEVHYPTRDEQRAEAKAREERAAWRLATRPLKEFFANAKK
FT                   GEGISPSTIRELLNELSEPPFAEGRLAPNARKAFELVAASAKETGSKRTFEEVEELVRG
FT                   VVNPLYHLLTYGVKAPGAEGGGPPSSVAETIAEQMHTAAVKLLAASLDILSKGDATKKA
FT                   VESAKGIVIVREQVAAKLAGRAPGGGRGDKETTVTRRDSVDGRGHGKGSAANKPAQASG
FT                   TDADRWDRKKDGRPTPSPEVYRAPRGGEKGVGVMARLGDKNDSSSPANGVKPRAVPKVV
FT                   IHRPFSEGKQRELTPSPAQQGQGERGGKPKPSPTPPQQGQKLSPFERGPASAASQALGK
FT                   SPPSARGGVFARLEGKPKLQGLGKSDLPAPKPDAAKELPHPKSTEKELPHPKRVVVVHK
FT                   PNEPNDHKELPHPKPAPKPRDPPAPPAKGARGDKEKPAKQRDALDDALDEELAKATKGK
FT                   KGGRTKGGSDRQGAPSEPHKELPHPKPAAPAPGSEKPHPVPAPRPVSAPDSESAKQLPH
FT                   PNKPPVPKGNNGRSPIPAPKPATNTNTGGSSVGGRPGSGKARNESASPPPPKERDELDD
FT                   VLDAELEKAMGGGGGGKRRPRGGRGSRGGGK"
     MEEAIAAAEA TLEALVKAAE DFAVPLIAEQ RAVLAAADAK AADAASPARD AFETVRAEFE        60
     KKIDELDGAL TSAVEKERAE IAVVARAARE DPFAEDEDAD VATIVASVFD PAREHLGERL       120
     RNSRSAAEKM LQWLERRAPD LDRAATDAAS KAADAGDGID DDSGKHEDWA ADEESDLEDL       180
     PPLGGDWAED DEDDLPPLEG EWQKDAEAGP SPTPPSPKKK PAAFKPRDAS PPRGNAWGHA       240
     PPAHGRDRSD AGHRMGPAAG RDVDLRDRLG GGGSRDYGGD RRSSFDRGGD YGRDRGGGGF       300
     RDSWGAPGGG YRDDRRGGGG GGGGHRSEYI ERMERKYGRV DDGPPPRSTM RDRSPPKPPP       360
     EVHYPTRDEQ RAEAKAREER AAWRLATRPL KEFFANAKKG EGISPSTIRE LLNELSEPPF       420
     AEGRLAPNAR KAFELVAASA KETGSKRTFE EVEELVRGVV NPLYHLLTYG VKAPGAEGGG       480
     PPSSVAETIA EQMHTAAVKL LAASLDILSK GDATKKAVES AKGIVIVREQ VAAKLAGRAP       540
     GGGRGDKETT VTRRDSVDGR GHGKGSAANK PAQASGTDAD RWDRKKDGRP TPSPEVYRAP       600
     RGGEKGVGVM ARLGDKNDSS SPANGVKPRA VPKVVIHRPF SEGKQRELTP SPAQQGQGER       660
     GGKPKPSPTP PQQGQKLSPF ERGPASAASQ ALGKSPPSAR GGVFARLEGK PKLQGLGKSD       720
     LPAPKPDAAK ELPHPKSTEK ELPHPKRVVV VHKPNEPNDH KELPHPKPAP KPRDPPAPPA       780
     KGARGDKEKP AKQRDALDDA LDEELAKATK GKKGGRTKGG SDRQGAPSEP HKELPHPKPA       840
     APAPGSEKPH PVPAPRPVSA PDSESAKQLP HPNKPPVPKG NNGRSPIPAP KPATNTNTGG       900
     SSVGGRPGSG KARNESASPP PPKERDELDD VLDAELEKAM GGGGGGKRRP RGGRGSRGGG       960
     K                                                                       961
//

If you have problems or comments...

PBIL Back to PBIL home page