(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE206

MICSR_1.PE206        Location/Qualifiers
FT   CDS             complement(416531..417379)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636546"
FT                   /orf_name="MICPUN_107887"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62125.1"
FT                   /db_xref="UniParc:UPI000199AA5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E183"
FT                   /transl_table=1
FT                   /translation="MAPRMMHPRVGTGEPDPEEDESEEEKKDGILIPLLTFFGFVFVFI
FT                   PITVMLMGAIFGLILAEVEGWKIKDGFYYIISMLCGLPTPLTEVDPDTDEGKLVDVIVA
FT                   LWALALAGTIIGVVGGLSVINRLVDAAESFGQRFKRAARKAVTGSDEEAPAAADEDGEE
FT                   KPVSLTLNVLTFLVFIFIVIPIVIILVAVLFGFILAEVEGWKIKDGFYYIISMLCGLPN
FT                   PLTDVTPDSDEGKIVDIIIALWALSLAGTIIGIVGGMSVINTLVESAEALGERFGKKKE
FT                   N"
     MAPRMMHPRV GTGEPDPEED ESEEEKKDGI LIPLLTFFGF VFVFIPITVM LMGAIFGLIL        60
     AEVEGWKIKD GFYYIISMLC GLPTPLTEVD PDTDEGKLVD VIVALWALAL AGTIIGVVGG       120
     LSVINRLVDA AESFGQRFKR AARKAVTGSD EEAPAAADED GEEKPVSLTL NVLTFLVFIF       180
     IVIPIVIILV AVLFGFILAE VEGWKIKDGF YYIISMLCGL PNPLTDVTPD SDEGKIVDII       240
     IALWALSLAG TIIGIVGGMS VINTLVESAE ALGERFGKKK EN                          282
//

If you have problems or comments...

PBIL Back to PBIL home page