(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE207

MICSR_1.PE207        Location/Qualifiers
FT   CDS             complement(417583..418845)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636547"
FT                   /orf_name="MICPUN_56780"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62126.1"
FT                   /db_xref="UniParc:UPI000199AA5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E184"
FT                   /transl_table=1
FT                   /translation="MAPVPPALFKARGTTLRADEYLRGVNPVGTVHRGPLSAFGRQEIS
FT                   ALRTEPSVAFSRTDRLEAIRPFSIEYFLPGEGNRAYAASHAREYLARHEAEGLDRFARP
FT                   AVSEPPEPRWKTFGRSGTHHDFAKTQARGGHLPLKPDWPNKNESRWGAAERLHRPLDGG
FT                   HDLVQYSSFARQRLSTHANSPKAYVDIGAATTRAERGRQTLGRAHDERSAALGACSPGP
FT                   QVPRDRDGFALGAVGRQIEAGRVTEPRAVVGSNSRVTAPTWAPAGVKGGDWTRPVRPDP
FT                   SVPGPGAYHETFDFRRTRGERGNGDGSGRRSTGRRTHRQLITGEAAIADERERRLASSF
FT                   NPKDAGAYWGSSGRGTLPSLSSSSSPAVPPLGSLGGGSPARTYPVSGKEIRARTRSGRW
FT                   TPRDEQRGRARRLLGRASPAP"
     MAPVPPALFK ARGTTLRADE YLRGVNPVGT VHRGPLSAFG RQEISALRTE PSVAFSRTDR        60
     LEAIRPFSIE YFLPGEGNRA YAASHAREYL ARHEAEGLDR FARPAVSEPP EPRWKTFGRS       120
     GTHHDFAKTQ ARGGHLPLKP DWPNKNESRW GAAERLHRPL DGGHDLVQYS SFARQRLSTH       180
     ANSPKAYVDI GAATTRAERG RQTLGRAHDE RSAALGACSP GPQVPRDRDG FALGAVGRQI       240
     EAGRVTEPRA VVGSNSRVTA PTWAPAGVKG GDWTRPVRPD PSVPGPGAYH ETFDFRRTRG       300
     ERGNGDGSGR RSTGRRTHRQ LITGEAAIAD ERERRLASSF NPKDAGAYWG SSGRGTLPSL       360
     SSSSSPAVPP LGSLGGGSPA RTYPVSGKEI RARTRSGRWT PRDEQRGRAR RLLGRASPAP       420
//

If you have problems or comments...

PBIL Back to PBIL home page