(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE208

MICSR_1.PE208        Location/Qualifiers
FT   CDS             419146..419886
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636548"
FT                   /orf_name="MICPUN_56781"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61694.1"
FT                   /db_xref="UniParc:UPI000199AA60"
FT                   /db_xref="UniProtKB/TrEMBL:C1E185"
FT                   /transl_table=1
FT                   /translation="MALVVTPTLASIAPAGRPSLGRSRGGTGAMTLPRPSTSSPRQPAK
FT                   PVGRSGRSSRGSIQVAASPLPIADVAALFDNPFSKAAEEVDSSLPGWFPALSFIAYVLV
FT                   LREVRRIRQREERKAREKMAKAAQEAAQRKVESMGPEVWGKLIVCLVIDALGDSSFLLP
FT                   GLGEGTDIAYAPLEAFLLSQLFRSNVVSGVGFVEEALPFTDVIPTATLAWMTETFFSDT
FT                   WPGRALGLGGDKPVEKEKDEKKDK"
     MALVVTPTLA SIAPAGRPSL GRSRGGTGAM TLPRPSTSSP RQPAKPVGRS GRSSRGSIQV        60
     AASPLPIADV AALFDNPFSK AAEEVDSSLP GWFPALSFIA YVLVLREVRR IRQREERKAR       120
     EKMAKAAQEA AQRKVESMGP EVWGKLIVCL VIDALGDSSF LLPGLGEGTD IAYAPLEAFL       180
     LSQLFRSNVV SGVGFVEEAL PFTDVIPTAT LAWMTETFFS DTWPGRALGL GGDKPVEKEK       240
     DEKKDK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page