(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE209

MICSR_1.PE209        Location/Qualifiers
FT   CDS             join(complement(420044..421005),complement(419946..419955))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636549"
FT                   /orf_name="MICPUN_56782"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62127.1"
FT                   /db_xref="UniParc:UPI000199AA61"
FT                   /db_xref="UniProtKB/TrEMBL:C1E186"
FT                   /transl_table=1
FT                   /translation="MRTRPAFGRCDCAGSDRGWEVAGGYTSEASHVRRSPTPDGNSLLG
FT                   GVAQLCHAFFHCSPTPELSSHPDELCLRVACDPAGRKCETKGVVVVAALRDRAGDLRFL
FT                   SRYSNCPLSSHAEEYVVRDEELVRAVMEMAPEDDARSSTKTPGSAGTLTLYQRLQPCHG
FT                   SSDNRGPLWSCSDALVAGLHRELLGPRGVSLRVAVSYTYRAHWDVRGFESERERRWWGP
FT                   KVEAAREGIRVFAAAAKDGVTLEALNAEDWAFLVSLCDEDVARDYAAAFGEGGEGFGSK
FT                   GCGVFTAPAVAHRRAMDEFVAEQIRRHSASGPTNGRATNAAG"
     MRTRPAFGRC DCAGSDRGWE VAGGYTSEAS HVRRSPTPDG NSLLGGVAQL CHAFFHCSPT        60
     PELSSHPDEL CLRVACDPAG RKCETKGVVV VAALRDRAGD LRFLSRYSNC PLSSHAEEYV       120
     VRDEELVRAV MEMAPEDDAR SSTKTPGSAG TLTLYQRLQP CHGSSDNRGP LWSCSDALVA       180
     GLHRELLGPR GVSLRVAVSY TYRAHWDVRG FESERERRWW GPKVEAAREG IRVFAAAAKD       240
     GVTLEALNAE DWAFLVSLCD EDVARDYAAA FGEGGEGFGS KGCGVFTAPA VAHRRAMDEF       300
     VAEQIRRHSA SGPTNGRATN AAG                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page