(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE210

MICSR_1.PE210        Location/Qualifiers
FT   CDS             421185..422681
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636550"
FT                   /orf_name="MICPUN_99363"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61695.1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="UniParc:UPI000199AABF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E187"
FT                   /transl_table=1
FT                   /translation="MGLFHEGDVVSAIAAAKAKGAPLLVFILGDDPSSAEMVRALEDSN
FT                   DGGGATLRSEAGDEGWVALRLAEGGTDAANFRALCPAGNAPVAVAVDARTGAKIGEASG
FT                   ADGADVLASKLKDLREAHESDLRLQTMAALARLAGAQTPANPAPATQPPPANPAPATHE
FT                   PPAQPAPAPRADDPSRDETSRGDASFAAADADAIFAKAKAEAELNAARAEMAARIKADA
FT                   ALKRAAAIEERARMAAEAEKRREDEAKRAAEEKERKAVEARERLGVAARIQLPDGTSVT
FT                   ARLPAGATIGDVRDFLVADAPEVDWKNLEIWNAWPRRVVDESDPTATVAEDLGLGARPS
FT                   LLAIYRVGGGNGGGSVTHRAGPGGVTAGGGGTAGGGALDALLGILRKIWALVCSFLGMD
FT                   LFAARGGGAAPRGDPVSHRPTAVPRGDGADGSNPVRRSGAGGGGNGNVHTLGGLRDDDD
FT                   EGDDGRNRFWNGNSTQFGGGPADADAGDAPMDGFYTSRNE"
     MGLFHEGDVV SAIAAAKAKG APLLVFILGD DPSSAEMVRA LEDSNDGGGA TLRSEAGDEG        60
     WVALRLAEGG TDAANFRALC PAGNAPVAVA VDARTGAKIG EASGADGADV LASKLKDLRE       120
     AHESDLRLQT MAALARLAGA QTPANPAPAT QPPPANPAPA THEPPAQPAP APRADDPSRD       180
     ETSRGDASFA AADADAIFAK AKAEAELNAA RAEMAARIKA DAALKRAAAI EERARMAAEA       240
     EKRREDEAKR AAEEKERKAV EARERLGVAA RIQLPDGTSV TARLPAGATI GDVRDFLVAD       300
     APEVDWKNLE IWNAWPRRVV DESDPTATVA EDLGLGARPS LLAIYRVGGG NGGGSVTHRA       360
     GPGGVTAGGG GTAGGGALDA LLGILRKIWA LVCSFLGMDL FAARGGGAAP RGDPVSHRPT       420
     AVPRGDGADG SNPVRRSGAG GGGNGNVHTL GGLRDDDDEG DDGRNRFWNG NSTQFGGGPA       480
     DADAGDAPMD GFYTSRNE                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page