(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE211

MICSR_1.PE211        Location/Qualifiers
FT   CDS             complement(422784..423821)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636551"
FT                   /orf_name="MICPUN_56784"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62128.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AAC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E188"
FT                   /transl_table=1
FT                   /translation="MSLLARTSRAAFSFLGSSQGTRALRLASTAAPPRGHHLHTAPRHL
FT                   PASHLARPSTAPSFATRAMSSGNDQATTHVPPAPGVSKLYAAEPVAGRCALITGASSGI
FT                   GQATAERLAELGCRLVVAARRKDRLDALATRLANDFGAKVHCVALDVTDVDAVMSLPSA
FT                   LPAEFADVSILVNNAGGALGTAKCTENNMDDVATMLDANVKGVVACTRAFSPGMVERGC
FT                   GHVVNISSIAGVEWYGGGSVYCATKAAINAFTYASRKDLHDTPCKITSVSPGFVNTEFA
FT                   TVRFKGDKGKADNVYAGMKYGGPLLAEDIADNIVYALTRPGRVQVCDMLVYPTCQASAR
FT                   DIARE"
     MSLLARTSRA AFSFLGSSQG TRALRLASTA APPRGHHLHT APRHLPASHL ARPSTAPSFA        60
     TRAMSSGNDQ ATTHVPPAPG VSKLYAAEPV AGRCALITGA SSGIGQATAE RLAELGCRLV       120
     VAARRKDRLD ALATRLANDF GAKVHCVALD VTDVDAVMSL PSALPAEFAD VSILVNNAGG       180
     ALGTAKCTEN NMDDVATMLD ANVKGVVACT RAFSPGMVER GCGHVVNISS IAGVEWYGGG       240
     SVYCATKAAI NAFTYASRKD LHDTPCKITS VSPGFVNTEF ATVRFKGDKG KADNVYAGMK       300
     YGGPLLAEDI ADNIVYALTR PGRVQVCDML VYPTCQASAR DIARE                       345
//

If you have problems or comments...

PBIL Back to PBIL home page