(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE212

MICSR_1.PE212        Location/Qualifiers
FT   CDS             424141..428529
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636552"
FT                   /orf_name="MICPUN_56785"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /protein_id="ACO61696.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199AAC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E189"
FT                   /transl_table=1
FT                   /translation="MVVATASGDGFAPHKGALDTAARAAETMWWWDPADRADRAKDGGG
FT                   APGKTKGVVASGARAGAWRTRDELVPAGSGVKTPTPARDRARWTPWDELVDCSEAPYFR
FT                   WFAGAKTNAAFNAVDRHVLDGRGDDCALTTLPEEEDPKAGVDGARLSVTRRELLGAVAA
FT                   AARDLRDRHGVKPRDRVLFHMPTDATHFAYMLACQRLGAAYSATAVDSVEGVLASRTAD
FT                   LAPKLVIAYAEPVVHGGQPVDCAAKLRSALDALNREGSEGSEPTGRGNEQSKGNKRTKK
FT                   ASSNDVDPKSKVPKTNVPAPALVLLPRWGAKKNVASAGAAQFRSLRDEDAFKSAQKICA
FT                   CEPCDSDHPLFVSYTSGSTGKPKGVVHGHGGYVSGVLQSMTTVFECAPGEGGDGVKGGI
FT                   LTVGSAGWITGQSYMLMGPLLAGVRSVVMVGSPVYPTPLRMIRAVESEGCTLLKTGSAV
FT                   VRQLMTDPSNAAKVDAIDTSTLRCATFCAEPVSVEVHKYSHDHITDKFINSYWATEHGA
FT                   MVFSRDVAAPNGLTARGVIKSDARTWPLPWVSAALDSESSDVVIAGPYPSLALTVFGDV
FT                   QNVYDQNWRGDFAKYKETYWPKDGGGFVQGDVARASGEKGGGFTFHGRSDEVINVNGNR
FT                   VGTEQIERCLWNLEADGYGVKDCAVVGAPDFVKGTTPVAFVVFEPLARGGKKRKVGAGA
FT                   PDLAAFKSAAATAVGDKVGSYAAPDHIFAVNALPKTITNKTARKTLQMLLAGGEPPSGN
FT                   LARAEVLPPIAEAVAEWRLTAATTTSTIDLGKYWRRYTMDDHNIQGRAIVPGAGWLALI
FT                   AHEAGTSKLADVAFMRGVFEPDTTIRVVKRRRLMQATAGEETILKASLVSGDAAPETIG
FT                   PDVFGRGVALGSPSKKKPARGKENGVEENSVADNGVEQSDASRNKNAEAVGVKITDDSN
FT                   HEQHYRRCSALRLEYGGAYRAIERVAWSGHAFRAECFPRTHLAAVLDAGLQVVCASVRA
FT                   NTFIPVAVADFQITEGVDAFDESRRCVVHGEILEQYPEFLVADLRYEYEGVQGSSGVQG
FT                   SKSGGVQGSSGKKKKKASVVSSSSAAAATTGNGVFASMGRARFARVEGTKPRLQPTKAK
FT                   EANPTASPFGSQTLDPKTALARLRQLTTEQRVDAVRSVIGSIVSDLTDADVDFSKTVFD
FT                   NGMHSLNAVELLSRLNQTLGTGVTTKLVVNDAPMADFAVAVAEHATTFESTADDPNAKP
FT                   FPNVDYANLNEIVRRRLAGKTVGNTPYWFLFKYITYNFWKKSFQFFRIGGHKFLMNPPR
FT                   EIDLSLEVRMDRVVEFRDVDMNQHYTVEMIVARSVDGVEQLMAKSGLTHIEHYYRRNLF
FT                   AAKIQSTFHKELAHGDRYVIKTKITKVTGSLMDIRVAFLDPDDVLCFEILWTILIVLDS
FT                   NERLLLDWENVDLMDSGRRLIAGPGKGRAEAPTSASKGLKSSSKPSSVAGVESGRTIHT
FT                   K"
     MVVATASGDG FAPHKGALDT AARAAETMWW WDPADRADRA KDGGGAPGKT KGVVASGARA        60
     GAWRTRDELV PAGSGVKTPT PARDRARWTP WDELVDCSEA PYFRWFAGAK TNAAFNAVDR       120
     HVLDGRGDDC ALTTLPEEED PKAGVDGARL SVTRRELLGA VAAAARDLRD RHGVKPRDRV       180
     LFHMPTDATH FAYMLACQRL GAAYSATAVD SVEGVLASRT ADLAPKLVIA YAEPVVHGGQ       240
     PVDCAAKLRS ALDALNREGS EGSEPTGRGN EQSKGNKRTK KASSNDVDPK SKVPKTNVPA       300
     PALVLLPRWG AKKNVASAGA AQFRSLRDED AFKSAQKICA CEPCDSDHPL FVSYTSGSTG       360
     KPKGVVHGHG GYVSGVLQSM TTVFECAPGE GGDGVKGGIL TVGSAGWITG QSYMLMGPLL       420
     AGVRSVVMVG SPVYPTPLRM IRAVESEGCT LLKTGSAVVR QLMTDPSNAA KVDAIDTSTL       480
     RCATFCAEPV SVEVHKYSHD HITDKFINSY WATEHGAMVF SRDVAAPNGL TARGVIKSDA       540
     RTWPLPWVSA ALDSESSDVV IAGPYPSLAL TVFGDVQNVY DQNWRGDFAK YKETYWPKDG       600
     GGFVQGDVAR ASGEKGGGFT FHGRSDEVIN VNGNRVGTEQ IERCLWNLEA DGYGVKDCAV       660
     VGAPDFVKGT TPVAFVVFEP LARGGKKRKV GAGAPDLAAF KSAAATAVGD KVGSYAAPDH       720
     IFAVNALPKT ITNKTARKTL QMLLAGGEPP SGNLARAEVL PPIAEAVAEW RLTAATTTST       780
     IDLGKYWRRY TMDDHNIQGR AIVPGAGWLA LIAHEAGTSK LADVAFMRGV FEPDTTIRVV       840
     KRRRLMQATA GEETILKASL VSGDAAPETI GPDVFGRGVA LGSPSKKKPA RGKENGVEEN       900
     SVADNGVEQS DASRNKNAEA VGVKITDDSN HEQHYRRCSA LRLEYGGAYR AIERVAWSGH       960
     AFRAECFPRT HLAAVLDAGL QVVCASVRAN TFIPVAVADF QITEGVDAFD ESRRCVVHGE      1020
     ILEQYPEFLV ADLRYEYEGV QGSSGVQGSK SGGVQGSSGK KKKKASVVSS SSAAAATTGN      1080
     GVFASMGRAR FARVEGTKPR LQPTKAKEAN PTASPFGSQT LDPKTALARL RQLTTEQRVD      1140
     AVRSVIGSIV SDLTDADVDF SKTVFDNGMH SLNAVELLSR LNQTLGTGVT TKLVVNDAPM      1200
     ADFAVAVAEH ATTFESTADD PNAKPFPNVD YANLNEIVRR RLAGKTVGNT PYWFLFKYIT      1260
     YNFWKKSFQF FRIGGHKFLM NPPREIDLSL EVRMDRVVEF RDVDMNQHYT VEMIVARSVD      1320
     GVEQLMAKSG LTHIEHYYRR NLFAAKIQST FHKELAHGDR YVIKTKITKV TGSLMDIRVA      1380
     FLDPDDVLCF EILWTILIVL DSNERLLLDW ENVDLMDSGR RLIAGPGKGR AEAPTSASKG      1440
     LKSSSKPSSV AGVESGRTIH TK                                               1462
//

If you have problems or comments...

PBIL Back to PBIL home page