(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE213

MICSR_1.PE213        Location/Qualifiers
FT   CDS             join(complement(430109..430266),complement(428644..429982))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636553"
FT                   /orf_name="MICPUN_105259"
FT                   /product="Predicted protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /function="protein dimerization activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62129.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AAC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E190"
FT                   /transl_table=1
FT                   /translation="MHSSSSGELETQRPVCRICWENTCEVNGSEEFLSPTPCSCRDERS
FT                   NVHQACLERWILEARSQGRFDAGTICHACGDHYSHPALSLTVLSDEAVRDAKISTASGG
FT                   GEGVDHREPLAIIGGTGYVGRSLALHLLGHPTFRLGAIVGSSATVGKPFSAVFEKKEEA
FT                   LAEHYGADLWKPMDFPTELMSARVCGVEDVIERGECRTALSFIAPEHGEIEDRLAAAGI
FT                   KVFSISPHARFDPSNPLSVPEANPEVLKDAVDKAAGEGFEGDCHSLVKSPNCVTCGVVV
FT                   ALKALDAAFGVEDVSVTTFQSLSGRGDAKYPRDVVMGNVYPLHGTVERTGEYQHGELKR
FT                   IMPDVKRVSVAAYRVPVQRGHLVDVRVRFRCETKPTARAVERALSSFDPLRDVPLPSKP
FT                   RRVIYVKPLDEEETGPRIGTPRPKDDHEYEGGMSVCVGNVVCEDELYDVRFCLVVNNVV
FT                   RGAWGAALLNAEYWHWLKGRKTAAPGEEPAAPSAAARIEC"
     MHSSSSGELE TQRPVCRICW ENTCEVNGSE EFLSPTPCSC RDERSNVHQA CLERWILEAR        60
     SQGRFDAGTI CHACGDHYSH PALSLTVLSD EAVRDAKIST ASGGGEGVDH REPLAIIGGT       120
     GYVGRSLALH LLGHPTFRLG AIVGSSATVG KPFSAVFEKK EEALAEHYGA DLWKPMDFPT       180
     ELMSARVCGV EDVIERGECR TALSFIAPEH GEIEDRLAAA GIKVFSISPH ARFDPSNPLS       240
     VPEANPEVLK DAVDKAAGEG FEGDCHSLVK SPNCVTCGVV VALKALDAAF GVEDVSVTTF       300
     QSLSGRGDAK YPRDVVMGNV YPLHGTVERT GEYQHGELKR IMPDVKRVSV AAYRVPVQRG       360
     HLVDVRVRFR CETKPTARAV ERALSSFDPL RDVPLPSKPR RVIYVKPLDE EETGPRIGTP       420
     RPKDDHEYEG GMSVCVGNVV CEDELYDVRF CLVVNNVVRG AWGAALLNAE YWHWLKGRKT       480
     AAPGEEPAAP SAAARIEC                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page