(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE215

MICSR_1.PE215        Location/Qualifiers
FT   CDS             complement(432175..434082)
FT                   /codon_start=1
FT                   /gene_family="HOG000201154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636555"
FT                   /orf_name="MICPUN_56788"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62130.1"
FT                   /db_xref="HOGENOM:HBG560065"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="UniParc:UPI000199AAC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E192"
FT                   /transl_table=1
FT                   /translation="MMTRIALFLVTLLPLAAASDVGNEGWTVPPFKCFGTTAVNKYEMT
FT                   SVPSDLSGITWNPSTKTLFAVNNGDRMIYEIEYPNKLIQKWDVKALTLDLEGISALGGR
FT                   KFAITDENPVKITEVTLNTDGTYSGATTLVQGITPKAASNLGFEGVTKIGTTYYAVQEV
FT                   SPAKLWKLESGATAYTDLSGDLEKHATYQLKSIGGLTRGGDATDELFLMAKTYTGTGRD
FT                   GSSKYYQKGIIRYKISDGTILERFGGEMCNMGQPEGLTFWKDDTSGKIRMLMVGETHEA
FT                   RLYEADPSCTDAIGSITNNMATCVEKKVSTATCEKTKADGGCPWTRCDKDITDHNKICT
FT                   DDTPGVTDCTETQCFNRCNNTLVKGNKCTHWAYDVAEKECYIFAGCKNDKFDADYTTYA
FT                   MEDPTCEKTRAKAPLGCEKRRCDKDISKHNKICTDDTPGTTDCTLDQCEDKCKKHTDFT
FT                   CTTYAYDVKEKECYLFETCEGEKFDEDYSTYVLRDPTCEEPRNSTGGGGCTQRRCDKDV
FT                   TPHTKICVDDCPEAQCTIDQCEIYCAQTTFTKEHAEAYCTHWAYDEVDKECYLFYGCKG
FT                   EQYDDDYTLFTQSYGERTKLQGKHGKTIAKTPTCPAKSGAASNVAGAFTFLAAAALVAV
FT                   "
     MMTRIALFLV TLLPLAAASD VGNEGWTVPP FKCFGTTAVN KYEMTSVPSD LSGITWNPST        60
     KTLFAVNNGD RMIYEIEYPN KLIQKWDVKA LTLDLEGISA LGGRKFAITD ENPVKITEVT       120
     LNTDGTYSGA TTLVQGITPK AASNLGFEGV TKIGTTYYAV QEVSPAKLWK LESGATAYTD       180
     LSGDLEKHAT YQLKSIGGLT RGGDATDELF LMAKTYTGTG RDGSSKYYQK GIIRYKISDG       240
     TILERFGGEM CNMGQPEGLT FWKDDTSGKI RMLMVGETHE ARLYEADPSC TDAIGSITNN       300
     MATCVEKKVS TATCEKTKAD GGCPWTRCDK DITDHNKICT DDTPGVTDCT ETQCFNRCNN       360
     TLVKGNKCTH WAYDVAEKEC YIFAGCKNDK FDADYTTYAM EDPTCEKTRA KAPLGCEKRR       420
     CDKDISKHNK ICTDDTPGTT DCTLDQCEDK CKKHTDFTCT TYAYDVKEKE CYLFETCEGE       480
     KFDEDYSTYV LRDPTCEEPR NSTGGGGCTQ RRCDKDVTPH TKICVDDCPE AQCTIDQCEI       540
     YCAQTTFTKE HAEAYCTHWA YDEVDKECYL FYGCKGEQYD DDYTLFTQSY GERTKLQGKH       600
     GKTIAKTPTC PAKSGAASNV AGAFTFLAAA ALVAV                                  635
//

If you have problems or comments...

PBIL Back to PBIL home page