(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE216

MICSR_1.PE216        Location/Qualifiers
FT   CDS             join(<434836..434949,435175..>435906)
FT                   /codon_start=1
FT                   /gene_family="HOG000200793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636556"
FT                   /orf_name="MICPUN_71524"
FT                   /product="Predicted protein"
FT                   /function="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase activity"
FT                   /biological_process="lipid A biosynthetic process "
FT                   /protein_id="ACO61698.1"
FT                   /db_xref="GO:0008759"
FT                   /db_xref="GO:0009245"
FT                   /db_xref="HOGENOM:HBG482342"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AAC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E193"
FT                   /transl_table=1
FT                   /translation="QQTVRRSFTLIGVGLHSGEWETVRVCPARAGEGRYFVRVRIPAAA
FT                   ALAQDNLRLSMRLAVDDDNGVITCEHLLSALEAIGVDNARIELEGSGEVPIVDGSAYQF
FT                   AYECARVGLVPAHADGSTAEVPRMAWRPSEMITVRDGDAFVQFIPDAVTKLTYGVDFTY
FT                   KSTAIGKQWESWTPTEDGDYVDLIARARTFGTMQDYMAYFRAGYIRGGLEQCALIANGD
FT                   KFWNPPMILPNENARHKILDLVGDLSLMAEPGMAGVPIGHVLAYKGSHRLHAKFLAALA
FT                   A"
     QQTVRRSFTL IGVGLHSGEW ETVRVCPARA GEGRYFVRVR IPAAAALAQD NLRLSMRLAV        60
     DDDNGVITCE HLLSALEAIG VDNARIELEG SGEVPIVDGS AYQFAYECAR VGLVPAHADG       120
     STAEVPRMAW RPSEMITVRD GDAFVQFIPD AVTKLTYGVD FTYKSTAIGK QWESWTPTED       180
     GDYVDLIARA RTFGTMQDYM AYFRAGYIRG GLEQCALIAN GDKFWNPPMI LPNENARHKI       240
     LDLVGDLSLM AEPGMAGVPI GHVLAYKGSH RLHAKFLAAL AA                          282
//

If you have problems or comments...

PBIL Back to PBIL home page