(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE218

MICSR_1.PE218        Location/Qualifiers
FT   CDS             join(437213..437412,437529..437638,437773..437831,
FT                   437995..439098)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636558"
FT                   /orf_name="MICPUN_99369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61699.1"
FT                   /db_xref="HOGENOM:HBG560067"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199AAC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E195"
FT                   /transl_table=1
FT                   /translation="MLLEKLPAHVLRDVFGFLSAGDVARAACACKTFKQVARSESLWRK
FT                   LLSEKLGSQASIVLPKTLPNERYPHGDMVVEPAWKEMFQFWMNPGPNSYSWMEHAKGEE
FT                   LENRGKFAARYLHRCTAIGDGNKILLFGGQGSGADFFNDLHLLDLRKKSLQLEQLDAAG
FT                   DPPFPRCSGTLTAVSVTGIPGSEVVALFGGSQGFFEGFSNSLCILQGDENVSISDAASQ
FT                   HKGLTWREPLVVAADPEDGVPDARWGHSAVSWNGKLVLFGGSNTQHCFNDTWVLDVGLN
FT                   PREPESRRLLATWKKLKLGNDARPPSRAGQTVSLVGDALYVFGGCHISDVFNDLWRLDL
FT                   GVRVPTWERLDVAGTPPAPRVGHAAVVLGDRIVFSGGRGSPTAGASGTYATADQGLATM
FT                   QGLTFFEGGFAMLDISRGTWMPIQHPNRNNHVYLRGEDDGAVDMEDAAMEDEVWEHRTG
FT                   HVMVPAKDGLLVIGGLAYNGEFQNDVQHIRVF"
     MLLEKLPAHV LRDVFGFLSA GDVARAACAC KTFKQVARSE SLWRKLLSEK LGSQASIVLP        60
     KTLPNERYPH GDMVVEPAWK EMFQFWMNPG PNSYSWMEHA KGEELENRGK FAARYLHRCT       120
     AIGDGNKILL FGGQGSGADF FNDLHLLDLR KKSLQLEQLD AAGDPPFPRC SGTLTAVSVT       180
     GIPGSEVVAL FGGSQGFFEG FSNSLCILQG DENVSISDAA SQHKGLTWRE PLVVAADPED       240
     GVPDARWGHS AVSWNGKLVL FGGSNTQHCF NDTWVLDVGL NPREPESRRL LATWKKLKLG       300
     NDARPPSRAG QTVSLVGDAL YVFGGCHISD VFNDLWRLDL GVRVPTWERL DVAGTPPAPR       360
     VGHAAVVLGD RIVFSGGRGS PTAGASGTYA TADQGLATMQ GLTFFEGGFA MLDISRGTWM       420
     PIQHPNRNNH VYLRGEDDGA VDMEDAAMED EVWEHRTGHV MVPAKDGLLV IGGLAYNGEF       480
     QNDVQHIRVF                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page