(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE22

MICSR_1.PE22         Location/Qualifiers
FT   CDS             39478..40530
FT                   /codon_start=1
FT                   /gene_family="HOG000079206" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636027"
FT                   /orf_name="MICPUN_79568"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61595.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AAB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P9"
FT                   /transl_table=1
FT                   /translation="MNGGNSELPTVSLASFIGECGGCVVGDEPTPEQRLTAGQIDAVFR
FT                   RHGFLYLTDFGVSEEDVRVVFNNMKRLFALNDEEKAKLSKFDPRTNTGFSKFATEALNT
FT                   LRPPDLKESFNIRSRKHYTNDYTGTPEGFGDVAESFWDKLEEASRRLFIACALAMKLPR
FT                   EDMRFFERTFRRFDFSTLRMLHFPPVEDFSPDKLTRDGDALRIGEHTDFGMVTLLFHDA
FT                   ESAGEGLQVKKADAGAGNDASGVAGTNTGWIDAISRGGATAIVNTGALIARWTNDEWRA
FT                   TAHRVVVPNDAAAGRDRYSLAFFLDPDKDEVIETHPRFSDAVDKYKPITSGGFVQMKIE
FT                   EMLKVQGKAT"
     MNGGNSELPT VSLASFIGEC GGCVVGDEPT PEQRLTAGQI DAVFRRHGFL YLTDFGVSEE        60
     DVRVVFNNMK RLFALNDEEK AKLSKFDPRT NTGFSKFATE ALNTLRPPDL KESFNIRSRK       120
     HYTNDYTGTP EGFGDVAESF WDKLEEASRR LFIACALAMK LPREDMRFFE RTFRRFDFST       180
     LRMLHFPPVE DFSPDKLTRD GDALRIGEHT DFGMVTLLFH DAESAGEGLQ VKKADAGAGN       240
     DASGVAGTNT GWIDAISRGG ATAIVNTGAL IARWTNDEWR ATAHRVVVPN DAAAGRDRYS       300
     LAFFLDPDKD EVIETHPRFS DAVDKYKPIT SGGFVQMKIE EMLKVQGKAT                  350
//

If you have problems or comments...

PBIL Back to PBIL home page