(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE220

MICSR_1.PE220        Location/Qualifiers
FT   CDS             join(442341..442805,442950..443651,443853..445088)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636560"
FT                   /orf_name="MICPUN_79939"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61700.1"
FT                   /db_xref="HOGENOM:HBG560068"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199AAC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E197"
FT                   /transl_table=1
FT                   /translation="MSTARPHLQLYETLVDCGRLHNALELLRALKTAGLNTVGGRVSNK
FT                   AFLRQCARRSAVAVAFDFVSFVDYPDVRLYNMLLSVCASAADSRSAFAAFVMMYDNGVQ
FT                   PDVMAYTTLISACAKAGELEKAFETFRRMEMDGLEGNVVTYGALMDALSRRVAATLRRC
FT                   FDLREEMDDAGVAPDGTMINTILSACGRAAEVRALSADALQKAFDLYDEMESSDEADLA
FT                   PDAYTYSALIKACVNAGQSMRGLSLYDRAMDPSAGIEPSIMVFQEAMIACSHLADLGKA
FT                   WAIWEDMRVERVAPDAMLYATLIAVAGRAGKREEAERVVFEMERAGVAPTPEVFASLAG
FT                   IAARAGDGAGVESAIAEVASRGLAVPLEMYNALVTAAARRGDVDAAQEAMFEAEAEMRA
FT                   AGLEPDEQTWCELLSSCARHGDASLTWDTYKRSRKAGQPPSEVALNILIGVTLLKIRAL
FT                   TDPDDRRNIKRMSQWDQDDDSAGRKKEEPEWTEWADRAIAAYHEATVAGVRPRLATFSA
FT                   MLACLRPPTLPSLRAVDRETRPGSKAESLARAVSHEDSSHEDARKYYPLRALIMYEEAQ
FT                   AIGVVPKFATETDSVYDIRKFPPAAAEVAVLTMLRVFRRRSDAHAGAGDDELPNVTLRV
FT                   LSDEEHEEMIASGDDEGRRLAQTGDRVIVLLRRLRFNYGGSLSAGRIELSGHVIKRWLQ
FT                   AKPPKDERAPGVEAGLRQNLQDQARNIRMQSFDDSDGSGYGGGATDWGAIFGRRGGGAG
FT                   GRLGVGRRPLLPRRRLVKGEKRTEDREERGVAREITSVPLARASHLL"
     MSTARPHLQL YETLVDCGRL HNALELLRAL KTAGLNTVGG RVSNKAFLRQ CARRSAVAVA        60
     FDFVSFVDYP DVRLYNMLLS VCASAADSRS AFAAFVMMYD NGVQPDVMAY TTLISACAKA       120
     GELEKAFETF RRMEMDGLEG NVVTYGALMD ALSRRVAATL RRCFDLREEM DDAGVAPDGT       180
     MINTILSACG RAAEVRALSA DALQKAFDLY DEMESSDEAD LAPDAYTYSA LIKACVNAGQ       240
     SMRGLSLYDR AMDPSAGIEP SIMVFQEAMI ACSHLADLGK AWAIWEDMRV ERVAPDAMLY       300
     ATLIAVAGRA GKREEAERVV FEMERAGVAP TPEVFASLAG IAARAGDGAG VESAIAEVAS       360
     RGLAVPLEMY NALVTAAARR GDVDAAQEAM FEAEAEMRAA GLEPDEQTWC ELLSSCARHG       420
     DASLTWDTYK RSRKAGQPPS EVALNILIGV TLLKIRALTD PDDRRNIKRM SQWDQDDDSA       480
     GRKKEEPEWT EWADRAIAAY HEATVAGVRP RLATFSAMLA CLRPPTLPSL RAVDRETRPG       540
     SKAESLARAV SHEDSSHEDA RKYYPLRALI MYEEAQAIGV VPKFATETDS VYDIRKFPPA       600
     AAEVAVLTML RVFRRRSDAH AGAGDDELPN VTLRVLSDEE HEEMIASGDD EGRRLAQTGD       660
     RVIVLLRRLR FNYGGSLSAG RIELSGHVIK RWLQAKPPKD ERAPGVEAGL RQNLQDQARN       720
     IRMQSFDDSD GSGYGGGATD WGAIFGRRGG GAGGRLGVGR RPLLPRRRLV KGEKRTEDRE       780
     ERGVAREITS VPLARASHLL                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page