(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE221

MICSR_1.PE221        Location/Qualifiers
FT   CDS             complement(445152..446276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636561"
FT                   /orf_name="MICPUN_56794"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62133.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199AACA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E198"
FT                   /transl_table=1
FT                   /translation="MGGTDGSPGSTTGRHHRDEEERSWLEMLAADDDVEGPSLLRAPDV
FT                   LTRNGASPDAPVLDDDGLLLRPLGSLGDDDDDFACGGDVCDLVHRAPVHGGIARGVISA
FT                   LRRSATDVGGELGRRRADVRAAASPRGVAPRGEARRRPPDRGGGGHTRGQHSPLAGGPG
FT                   DASLVERLRDSLCPDRAEDLSERRGARGGLRRARTLPTNLHAHDDDLPLDPRAAQADVV
FT                   AARAVEAAAQAASPRPFGYLGVTRPPWTTRWEANLVDEHTGGHVFLGNFDQKESAARAH
FT                   DAAKLKLALGDDEPVPQDQLNFDASDYREELSAMTECTFEDFVKTLVTHSYGGSRSAGH
FT                   SKFRGVFAREDGLWEAKLDAEDAGGAREDRRWKK"
     MGGTDGSPGS TTGRHHRDEE ERSWLEMLAA DDDVEGPSLL RAPDVLTRNG ASPDAPVLDD        60
     DGLLLRPLGS LGDDDDDFAC GGDVCDLVHR APVHGGIARG VISALRRSAT DVGGELGRRR       120
     ADVRAAASPR GVAPRGEARR RPPDRGGGGH TRGQHSPLAG GPGDASLVER LRDSLCPDRA       180
     EDLSERRGAR GGLRRARTLP TNLHAHDDDL PLDPRAAQAD VVAARAVEAA AQAASPRPFG       240
     YLGVTRPPWT TRWEANLVDE HTGGHVFLGN FDQKESAARA HDAAKLKLAL GDDEPVPQDQ       300
     LNFDASDYRE ELSAMTECTF EDFVKTLVTH SYGGSRSAGH SKFRGVFARE DGLWEAKLDA       360
     EDAGGAREDR RWKK                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page