(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE222

MICSR_1.PE222        Location/Qualifiers
FT   CDS             join(complement(447390..448301),c
FT                   omplement(<447183..447359))
FT                   /codon_start=1
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636562"
FT                   /orf_name="MICPUN_79518"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62134.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="UniParc:UPI000199AB35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E199"
FT                   /transl_table=1
FT                   /translation="MKFDVEVFRYIEKDAWRVLVSVEMGMKNHELVPVELINAISGLKH
FT                   GGAFKFIRDLLKHKLVHHDNSKYDAYRLTPLGYDYLAIKAFVNRGAIEGVGRRIGVGKE
FT                   SDVYEVVTEDGETLALKLHRLGRTSFRAVKSKRDYIKKTTTHTNWLYLSRLAALKEHAF
FT                   MKALGDNGFPVPVAVDVNRHAVLMSIVDGYPLTQVGPSRLETGAVGRVYKQCVDQLENL
FT                   ARHGLVHCDFNEFNIMVNPETTNITVIDFPQMVSTKHPNAEELFVRDLKCLHKFFLRRF
FT                   DYRASEDPDGRRDPVFFEIAGGGKSLDVSLRASGFTQKQSKELEEYQAAKEAEENGGGG
FT                   GGDDDDEDDDDEDDDSELDDDDD"
     MKFDVEVFRY IEKDAWRVLV SVEMGMKNHE LVPVELINAI SGLKHGGAFK FIRDLLKHKL        60
     VHHDNSKYDA YRLTPLGYDY LAIKAFVNRG AIEGVGRRIG VGKESDVYEV VTEDGETLAL       120
     KLHRLGRTSF RAVKSKRDYI KKTTTHTNWL YLSRLAALKE HAFMKALGDN GFPVPVAVDV       180
     NRHAVLMSIV DGYPLTQVGP SRLETGAVGR VYKQCVDQLE NLARHGLVHC DFNEFNIMVN       240
     PETTNITVID FPQMVSTKHP NAEELFVRDL KCLHKFFLRR FDYRASEDPD GRRDPVFFEI       300
     AGGGKSLDVS LRASGFTQKQ SKELEEYQAA KEAEENGGGG GGDDDDEDDD DEDDDSELDD       360
     DDD                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page