(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE225

MICSR_1.PE225        Location/Qualifiers
FT   CDS             452045..>452964
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636565"
FT                   /orf_name="MICPUN_56798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61702.1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniParc:UPI000199AB38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A2"
FT                   /transl_table=1
FT                   /translation="MWRRLLRGAEVWEDRQRTVLVTEASPGRWIRPVHEEDDLANPCVD
FT                   PCVECELLEDRCVGWVHVRDLQLSAPEPETHALRASRRYRGHRGLLHVPSVVAFVEAHV
FT                   ARTREDRARYKRGGTTGPSLFDASGFVQAAFANASSPRPVFIPRRVHEQHHFAEPVDDL
FT                   NEATPGDLVFFGVQPPNAFKGCVDVRHVGIITAVRCISGSSASCVELAFASVTDPIAGR
FT                   GIVARDSVIVPSRSSTPGARGGNWSTTWEFGRARPGPEHEGDAASERLAQTVLSVGRCR
FT                   RGVEGADDLPRGRTASSARCGGSSR"
     MWRRLLRGAE VWEDRQRTVL VTEASPGRWI RPVHEEDDLA NPCVDPCVEC ELLEDRCVGW        60
     VHVRDLQLSA PEPETHALRA SRRYRGHRGL LHVPSVVAFV EAHVARTRED RARYKRGGTT       120
     GPSLFDASGF VQAAFANASS PRPVFIPRRV HEQHHFAEPV DDLNEATPGD LVFFGVQPPN       180
     AFKGCVDVRH VGIITAVRCI SGSSASCVEL AFASVTDPIA GRGIVARDSV IVPSRSSTPG       240
     ARGGNWSTTW EFGRARPGPE HEGDAASERL AQTVLSVGRC RRGVEGADDL PRGRTASSAR       300
     CGGSSR                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page