(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE227

MICSR_1.PE227        Location/Qualifiers
FT   CDS             454797..457436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636567"
FT                   /orf_name="MICPUN_99376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61703.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A4"
FT                   /transl_table=1
FT                   /translation="MDGAYESARARLKAQSKREPGADPGATRFGATRSRSLLSGGTKPK
FT                   ASSDGRERATTVEVVQGADDNIVDAQGRMTRALLHDATGCRDLSSATVADLHNADLTAL
FT                   ASGDLDACPNLVSLDLSFNQLVDIDGDALAPLTNLRALIVYNNRVASVKAVARVGQSLQ
FT                   TLQCQNNAITSLDGVEHLRRLAVLNASGNPLGDCKLIGRCTTLTRLDISRCGLEKLEGF
FT                   ATLHALEELNVSGNALTEISAVAKCAKLQELDVSHNALPPSALRDLKALKRLDVLNLEG
FT                   NALDHLNSMPRMEELTELNCAKNPLRTLPDDFPAKCPELQILDLGECQLAGDVASVVKA
FT                   LCGLDTLTELRLKFNPCAGGGSGGGHRPGRTHRRSSAAATAGRSTAPAASRPPARSAPT
FT                   AAGRRIRTAGPGTTGATMSARPPAPPPRAPARPPPPPQPDVSGDVWTPAADPWRGLDRA
FT                   AAAAATLGYRREVIRALPRCLYLDDVAVGDAERGGEEGGAGPRTRPDVPDVTDVTAGDD
FT                   GDERDENDVDALLKRRPQSARRPKAADMSAKAATADGHYEDVAVKFIKEMEDYKTKMSG
FT                   LIGKIRDGLKETRQEAVAALRSDGTLEAESDAVPSGRLPSAPIVGSVPTKKVGVLNKVD
FT                   EDKVGREAEAADSALRRGAEPPAAAVVQASPSPGKRPASARAKLVEAQDATRAVLEQFD
FT                   RLFSDKLFLDDVDGVGSPEGDEGITRTPEDRRRWIVRPPSARGGRPRSARGAGGIAEKV
FT                   AAAVAAVDAQLAAEVRDQKRAASEEEGTRATALAGTSKARPRSGGGNGGAGLGDDKDGR
FT                   RLRPPSLAGGSTGTLGKVLERTRTSSAAVAASRRPPSSGRLSTSGAAGGRGVPRATFRK
FT                   PPASGERR"
     MDGAYESARA RLKAQSKREP GADPGATRFG ATRSRSLLSG GTKPKASSDG RERATTVEVV        60
     QGADDNIVDA QGRMTRALLH DATGCRDLSS ATVADLHNAD LTALASGDLD ACPNLVSLDL       120
     SFNQLVDIDG DALAPLTNLR ALIVYNNRVA SVKAVARVGQ SLQTLQCQNN AITSLDGVEH       180
     LRRLAVLNAS GNPLGDCKLI GRCTTLTRLD ISRCGLEKLE GFATLHALEE LNVSGNALTE       240
     ISAVAKCAKL QELDVSHNAL PPSALRDLKA LKRLDVLNLE GNALDHLNSM PRMEELTELN       300
     CAKNPLRTLP DDFPAKCPEL QILDLGECQL AGDVASVVKA LCGLDTLTEL RLKFNPCAGG       360
     GSGGGHRPGR THRRSSAAAT AGRSTAPAAS RPPARSAPTA AGRRIRTAGP GTTGATMSAR       420
     PPAPPPRAPA RPPPPPQPDV SGDVWTPAAD PWRGLDRAAA AAATLGYRRE VIRALPRCLY       480
     LDDVAVGDAE RGGEEGGAGP RTRPDVPDVT DVTAGDDGDE RDENDVDALL KRRPQSARRP       540
     KAADMSAKAA TADGHYEDVA VKFIKEMEDY KTKMSGLIGK IRDGLKETRQ EAVAALRSDG       600
     TLEAESDAVP SGRLPSAPIV GSVPTKKVGV LNKVDEDKVG REAEAADSAL RRGAEPPAAA       660
     VVQASPSPGK RPASARAKLV EAQDATRAVL EQFDRLFSDK LFLDDVDGVG SPEGDEGITR       720
     TPEDRRRWIV RPPSARGGRP RSARGAGGIA EKVAAAVAAV DAQLAAEVRD QKRAASEEEG       780
     TRATALAGTS KARPRSGGGN GGAGLGDDKD GRRLRPPSLA GGSTGTLGKV LERTRTSSAA       840
     VAASRRPPSS GRLSTSGAAG GRGVPRATFR KPPASGERR                              879
//

If you have problems or comments...

PBIL Back to PBIL home page