(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE228

MICSR_1.PE228        Location/Qualifiers
FT   CDS             join(complement(458803..459027),complement(458436..458529),
FT                   complement(457689..458161))
FT                   /codon_start=1
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636568"
FT                   /orf_name="MICPUN_93665"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="ACO62137.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI000199AB3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A5"
FT                   /transl_table=1
FT                   /translation="MFEARLVQGSLLKKVLESIKDLVTDANFDCSNNGFALQAMDSSHV
FT                   SLVALLLRSDGFEHYRCDRNMTMGMNLSNMSKMLKCAGNEDIITMKADDTGDVVTFMFE
FT                   SPDQDKISDFELKLMDIDSEHLGIPDTEYAATVKMPSSEFMRICRDLSSIGDTVTISVS
FT                   KDGVKFSTTGDIGQANITCRQNTSVDKEEQTIIELQEPVTLTFALRYLNSFTKATPLAP
FT                   TVQLQMSKELPVVVQYLIADMGYVRYYLAPKIEDDETAEAA"
     MFEARLVQGS LLKKVLESIK DLVTDANFDC SNNGFALQAM DSSHVSLVAL LLRSDGFEHY        60
     RCDRNMTMGM NLSNMSKMLK CAGNEDIITM KADDTGDVVT FMFESPDQDK ISDFELKLMD       120
     IDSEHLGIPD TEYAATVKMP SSEFMRICRD LSSIGDTVTI SVSKDGVKFS TTGDIGQANI       180
     TCRQNTSVDK EEQTIIELQE PVTLTFALRY LNSFTKATPL APTVQLQMSK ELPVVVQYLI       240
     ADMGYVRYYL APKIEDDETA EAA                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page