(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE229

MICSR_1.PE229        Location/Qualifiers
FT   CDS             459532..459873
FT                   /codon_start=1
FT                   /gene_family="HOG000183826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636569"
FT                   /orf_name="MICPUN_80228"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61704.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A6"
FT                   /transl_table=1
FT                   /translation="MDDDRGGRFESIPENDSGAPGPAKSVEGWIVLVTGVHEEAQEDDL
FT                   HEHFADYGEIRNMHLNLDRRTGFVKGYALIEYETKKEAQAAIDGANGSSMLDQTLEVSF
FT                   AFSKGPINK"
     MDDDRGGRFE SIPENDSGAP GPAKSVEGWI VLVTGVHEEA QEDDLHEHFA DYGEIRNMHL        60
     NLDRRTGFVK GYALIEYETK KEAQAAIDGA NGSSMLDQTL EVSFAFSKGP INK              113
//

If you have problems or comments...

PBIL Back to PBIL home page