(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE23

MICSR_1.PE23         Location/Qualifiers
FT   CDS             complement(40580..41458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636028"
FT                   /orf_name="MICPUN_80078"
FT                   /product="Glycosyltransferase family 7 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62040.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="UniParc:UPI000199AAB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q0"
FT                   /transl_table=1
FT                   /translation="MLPQSINSLIGAAAANFATKGGSATLHHTVVPGDASVVWQREVLG
FT                   VCVPYRDRRDQLEVFASHLRTFLHGQGVPFRIYVGEQMAGGSFNRGWALNVAYKFAEPE
FT                   VDYVVFHDVDMLPLPGVDYRYSSMEGMDARHLSTEISQFGYKIPYNRYCSGVFMSRKEF
FT                   FRDINGFATTFWGWGGEDDEFCARWAKKKFGGWEAAEAAPGGLHNMFGRPEKGRGRFLS
FT                   MEAGHKSDRKNPHWKKNDQKLQSFLSSPETVNKADGLSTTGEPTQILKGKVETPLYTVY
FT                   RSSFPPNLRQP"
     MLPQSINSLI GAAAANFATK GGSATLHHTV VPGDASVVWQ REVLGVCVPY RDRRDQLEVF        60
     ASHLRTFLHG QGVPFRIYVG EQMAGGSFNR GWALNVAYKF AEPEVDYVVF HDVDMLPLPG       120
     VDYRYSSMEG MDARHLSTEI SQFGYKIPYN RYCSGVFMSR KEFFRDINGF ATTFWGWGGE       180
     DDEFCARWAK KKFGGWEAAE AAPGGLHNMF GRPEKGRGRF LSMEAGHKSD RKNPHWKKND       240
     QKLQSFLSSP ETVNKADGLS TTGEPTQILK GKVETPLYTV YRSSFPPNLR QP               292
//

If you have problems or comments...

PBIL Back to PBIL home page