(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE230

MICSR_1.PE230        Location/Qualifiers
FT   CDS             join(complement(461189..461536),complement(459947..461014))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636570"
FT                   /orf_name="MICPUN_105261"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62138.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AB3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A7"
FT                   /transl_table=1
FT                   /translation="MVEVGAPGAAAHAVAFCRACTCAFPVVLLVFLAAFTSLPGRYDSH
FT                   VVVRSYAGYLPVVKDEPAVFGPRVPADGVTARLEEASPKEACEALTNKYEGRWIALVQR
FT                   SFGTEKCDFVTKVRNAEMAGAVAVVVFDNVDGPLIPMAKKNEDNDVNVPSVFVSKESGE
FT                   ALETLLNDPKHGKTVVVTLESPDSPFDDWPNVATSACVTFGALCVLLSVVLVLKRREQA
FT                   HLAAMAAQRPPETRLLSAEEVAAVAKTAVFSSQERVLSFLRGATCGGAHASAGDGDGED
FT                   DKLVVDNGTGDTCAVCIEDYESGDELRALDCGHAFHKDCIDPWLITKRACCPVCKHVIA
FT                   PPPPPENVPDSRRRRRSRWSVLSNASVATVGGAESADESDLEAPLLPASSPARSLRRGV
FT                   MRWLTRRTAAGHPDASPAVSPDSDADDSDPGGVDDGGDESTGPGGGEEGPAGGDLEAGE
FT                   ARAGGADGTDGEQ"
     MVEVGAPGAA AHAVAFCRAC TCAFPVVLLV FLAAFTSLPG RYDSHVVVRS YAGYLPVVKD        60
     EPAVFGPRVP ADGVTARLEE ASPKEACEAL TNKYEGRWIA LVQRSFGTEK CDFVTKVRNA       120
     EMAGAVAVVV FDNVDGPLIP MAKKNEDNDV NVPSVFVSKE SGEALETLLN DPKHGKTVVV       180
     TLESPDSPFD DWPNVATSAC VTFGALCVLL SVVLVLKRRE QAHLAAMAAQ RPPETRLLSA       240
     EEVAAVAKTA VFSSQERVLS FLRGATCGGA HASAGDGDGE DDKLVVDNGT GDTCAVCIED       300
     YESGDELRAL DCGHAFHKDC IDPWLITKRA CCPVCKHVIA PPPPPENVPD SRRRRRSRWS       360
     VLSNASVATV GGAESADESD LEAPLLPASS PARSLRRGVM RWLTRRTAAG HPDASPAVSP       420
     DSDADDSDPG GVDDGGDEST GPGGGEEGPA GGDLEAGEAR AGGADGTDGE Q                471
//

If you have problems or comments...

PBIL Back to PBIL home page