(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE231

MICSR_1.PE231        Location/Qualifiers
FT   CDS             461794..462027
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636571"
FT                   /orf_name="MICPUN_107890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61705.1"
FT                   /db_xref="UniParc:UPI000199AB3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A8"
FT                   /transl_table=1
FT                   /translation="MFSTRLFLVALLAVFGALTLAPAPCEGKITYIRPLWQPTSEWSPP
FT                   EEREEPAELHSAAMKLYSEYVEKSGIQPCTYC"
     MFSTRLFLVA LLAVFGALTL APAPCEGKIT YIRPLWQPTS EWSPPEEREE PAELHSAAMK        60
     LYSEYVEKSG IQPCTYC                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page