(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE232

MICSR_1.PE232        Location/Qualifiers
FT   CDS             join(complement(462554..>463203),
FT                   complement(<462361..462445))
FT                   /codon_start=1
FT                   /gene_family="HOG000265856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636572"
FT                   /orf_name="MICPUN_70927"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62139.1"
FT                   /db_xref="HOGENOM:HBG635664"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="UniParc:UPI000199AB3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A9"
FT                   /transl_table=1
FT                   /translation="KPAVVVLPGLGNCTEDYDEFASELELRGFSATVAAVGRPDWLRNA
FT                   AGLTQLAYWQGTLEPRPTVDWYLSRIADAVAAAKEKSGADRVALVAHSAGGWMSRVYMQ
FT                   DFGVDDIRCVVTLGSPLNAVPKDVPGVVDQTRGILTYVEANCAKPTELGVPVTCLAGKW
FT                   LLGVETLGGAGDAAGFLVGQGYKQVCGSAAAWGDGITPVATAHLDGADNVTLEGVFHTP
FT                   IGSSDERPWYGTPKVLDQWVDKL"
     KPAVVVLPGL GNCTEDYDEF ASELELRGFS ATVAAVGRPD WLRNAAGLTQ LAYWQGTLEP        60
     RPTVDWYLSR IADAVAAAKE KSGADRVALV AHSAGGWMSR VYMQDFGVDD IRCVVTLGSP       120
     LNAVPKDVPG VVDQTRGILT YVEANCAKPT ELGVPVTCLA GKWLLGVETL GGAGDAAGFL       180
     VGQGYKQVCG SAAAWGDGIT PVATAHLDGA DNVTLEGVFH TPIGSSDERP WYGTPKVLDQ       240
     WVDKL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page