(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE233

MICSR_1.PE233        Location/Qualifiers
FT   CDS             complement(<464529..465057)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636573"
FT                   /orf_name="MICPUN_79707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62140.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B0"
FT                   /transl_table=1
FT                   /translation="MRTKLTVLPAAVARLSGLRTLILSDNSLTSLPAEIGELSQLRVLE
FT                   AERNQIASIPDEIANCKNLENIRVGYNKITDLSALADCDNLVTLVVDGNALDSLESLNL
FT                   REKQRLVTLSAKKNGIESVPADLGKCQLLAEIFLNDNKIGDLPMSMGELKEKKVRAIEL
FT                   DGNPLNDPKVKKM"
     MRTKLTVLPA AVARLSGLRT LILSDNSLTS LPAEIGELSQ LRVLEAERNQ IASIPDEIAN        60
     CKNLENIRVG YNKITDLSAL ADCDNLVTLV VDGNALDSLE SLNLREKQRL VTLSAKKNGI       120
     ESVPADLGKC QLLAEIFLND NKIGDLPMSM GELKEKKVRA IELDGNPLND PKVKKM           176
//

If you have problems or comments...

PBIL Back to PBIL home page