(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE234

MICSR_1.PE234        Location/Qualifiers
FT   CDS             join(466161..466238,466379..466948)
FT                   /codon_start=1
FT                   /gene_family="HOG000243523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636574"
FT                   /orf_name="MICPUN_90229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61706.1"
FT                   /db_xref="HOGENOM:HBG560076"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniParc:UPI000199AB41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B1"
FT                   /transl_table=1
FT                   /translation="MALCMSTSASVAKVARPAVRASAEEKPASVPRRVTNALAAAALSA
FT                   SIALAGPVSSANAEIRLPPLDPDPERCERAFVGNTIGQANAVSDRILDLRQCNYVDKDL
FT                   STKTLSGALMVDATFKGANMTEVVMSKAYAVNADFTGANFTNAVVDRVTFDGANLSNAN
FT                   FFNAVITGATFEGTNLAGAQFDEALIGKEDVKKLCENPTLVEETRFQVGCRN"
     MALCMSTSAS VAKVARPAVR ASAEEKPASV PRRVTNALAA AALSASIALA GPVSSANAEI        60
     RLPPLDPDPE RCERAFVGNT IGQANAVSDR ILDLRQCNYV DKDLSTKTLS GALMVDATFK       120
     GANMTEVVMS KAYAVNADFT GANFTNAVVD RVTFDGANLS NANFFNAVIT GATFEGTNLA       180
     GAQFDEALIG KEDVKKLCEN PTLVEETRFQ VGCRN                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page