(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE235

MICSR_1.PE235        Location/Qualifiers
FT   CDS             complement(467081..468481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636575"
FT                   /orf_name="MICPUN_56808"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62141.1"
FT                   /db_xref="UniParc:UPI000199AB42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B2"
FT                   /transl_table=1
FT                   /translation="MAAQIRAATATGIAHARRRRMPSRCARAFRAAASGSISGARSESD
FT                   ERTDAVRARLMRELARGRTGSVPRVMGPIVSEPRPDDGVVIDRLTLAPESRNEGLEHAV
FT                   PVAVVRPHGDWDDALPVVAFLHGTGGDTEGLMPQLMSIAARGYVAVGVDAPCHGRRLEP
FT                   GSAAHVADGDDDERSHHPSKSSAGAPAAEGLGHGSGNSRERTFERYGAALVAAWRRGNI
FT                   EGENGTGSGGNEGSRRGDARPFLFDGAWDALRALRFVTRGDEYGDLTDPSRVGIGGISL
FT                   GGMYAWLAGAADPGLVTGAVAPIVGVQHFAWGLLNDSWRARADSLPPALFAAAAEELVG
FT                   DPSAVDAGIVGAVYRRICPGLIDELDGPATLPLISPRPLLVVNGELDPRCPFPGLMNAV
FT                   TETRAAYASVGKTSLFRTLVQRRTPHRCTPEMVDVVNRWFDETLRPARPDVALPTRGHL
FT                   DPNTWIEL"
     MAAQIRAATA TGIAHARRRR MPSRCARAFR AAASGSISGA RSESDERTDA VRARLMRELA        60
     RGRTGSVPRV MGPIVSEPRP DDGVVIDRLT LAPESRNEGL EHAVPVAVVR PHGDWDDALP       120
     VVAFLHGTGG DTEGLMPQLM SIAARGYVAV GVDAPCHGRR LEPGSAAHVA DGDDDERSHH       180
     PSKSSAGAPA AEGLGHGSGN SRERTFERYG AALVAAWRRG NIEGENGTGS GGNEGSRRGD       240
     ARPFLFDGAW DALRALRFVT RGDEYGDLTD PSRVGIGGIS LGGMYAWLAG AADPGLVTGA       300
     VAPIVGVQHF AWGLLNDSWR ARADSLPPAL FAAAAEELVG DPSAVDAGIV GAVYRRICPG       360
     LIDELDGPAT LPLISPRPLL VVNGELDPRC PFPGLMNAVT ETRAAYASVG KTSLFRTLVQ       420
     RRTPHRCTPE MVDVVNRWFD ETLRPARPDV ALPTRGHLDP NTWIEL                      466
//

If you have problems or comments...

PBIL Back to PBIL home page