(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE236

MICSR_1.PE236        Location/Qualifiers
FT   CDS             468580..469839
FT                   /codon_start=1
FT                   /gene_family="HOG000251397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636576"
FT                   /orf_name="MICPUN_56809"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61707.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG527018"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B3"
FT                   /transl_table=1
FT                   /translation="MADRKYDIVLFGVTGFTGKLACEHLLSKGYPVRWAVCARTEAKAR
FT                   SVLASIASRLGVPDDVLPPILVADLQPSNSDPEHARLRGVVRDAAVVITAAGPFEKYGE
FT                   HLVRMCAEEGTHYADTTGESDFFRRCIDLHDATARATGATIVSHCGNDCVPWDLAVLAA
FT                   AELARDRFGPRTTLSAASTFTELPPGVGASGGTLATAIYQLGKKRGGSRTAFDPLLRLP
FT                   DGSKSKEATKVRSPKSDVYYEEFGAYAGPWIMQPVMGNCVRRSNALLGYNAGEEFAYSE
FT                   AQLRHPSFIRWIADSSYNALIGAAIYVPPLCALLPAPGEGPSREEMIAGYLKLHLRAEG
FT                   KAPDGKKFKVKGLMTFDEDTGYLCTGRMLAESGMELLEAAKAGGEKKAGVLTPATAMGT
FT                   SLLRRMERELPMKWEVEIAD"
     MADRKYDIVL FGVTGFTGKL ACEHLLSKGY PVRWAVCART EAKARSVLAS IASRLGVPDD        60
     VLPPILVADL QPSNSDPEHA RLRGVVRDAA VVITAAGPFE KYGEHLVRMC AEEGTHYADT       120
     TGESDFFRRC IDLHDATARA TGATIVSHCG NDCVPWDLAV LAAAELARDR FGPRTTLSAA       180
     STFTELPPGV GASGGTLATA IYQLGKKRGG SRTAFDPLLR LPDGSKSKEA TKVRSPKSDV       240
     YYEEFGAYAG PWIMQPVMGN CVRRSNALLG YNAGEEFAYS EAQLRHPSFI RWIADSSYNA       300
     LIGAAIYVPP LCALLPAPGE GPSREEMIAG YLKLHLRAEG KAPDGKKFKV KGLMTFDEDT       360
     GYLCTGRMLA ESGMELLEAA KAGGEKKAGV LTPATAMGTS LLRRMERELP MKWEVEIAD        419
//

If you have problems or comments...

PBIL Back to PBIL home page