(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE237

MICSR_1.PE237        Location/Qualifiers
FT   CDS             complement(<470440..>471108)
FT                   /codon_start=1
FT                   /gene_family="HOG000200794" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636577"
FT                   /orf_name="MICPUN_69262"
FT                   /product="Cytochrome oxidase biogenesis family "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62142.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG317219"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000199AB44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B4"
FT                   /transl_table=1
FT                   /translation="HLAHDMEWWAAIMATTAIMRVFVMPFMVMQQRVAARMHIAKPEIE
FT                   ALNARIKGMGGDQQVMAEAQKEIFAIWKKHNCNPAYMMLPIAVQAPLFISFYFAISEMA
FT                   KGVPSFASGGPDWPLGPISMHDLTAADPTYIMPVLSSATFLATVELGGAGNPETSGAAQ
FT                   QTMMTKWGLRALSVALIPMTAGFSKGVFVYWITTNMFSLGQTLAFKVPLIKKIVAIPEI
FT                   P"
     HLAHDMEWWA AIMATTAIMR VFVMPFMVMQ QRVAARMHIA KPEIEALNAR IKGMGGDQQV        60
     MAEAQKEIFA IWKKHNCNPA YMMLPIAVQA PLFISFYFAI SEMAKGVPSF ASGGPDWPLG       120
     PISMHDLTAA DPTYIMPVLS SATFLATVEL GGAGNPETSG AAQQTMMTKW GLRALSVALI       180
     PMTAGFSKGV FVYWITTNMF SLGQTLAFKV PLIKKIVAIP EIP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page