(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE238

MICSR_1.PE238        Location/Qualifiers
FT   CDS             complement(471802..474087)
FT                   /codon_start=1
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636578"
FT                   /orf_name="MICPUN_80021"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62143.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199ABB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B5"
FT                   /transl_table=1
FT                   /translation="MSLANLARASSGPGASVRRPATVQRHAASLSGTAPAKASASKIWR
FT                   RRAPVLLGARAASRDDAGPTGTSPTSSVAGSNDATGAAAASDARIPTYHLHEEEHDFDV
FT                   IVVGAGHAGCEAALAASRRGARTLLLTLSLDRIAWQPCNPAVGGPAKSQLVHEVDALGG
FT                   EIGKMADKCYLQKRVLNASRGPAVWALRAQTDKWEYSREMRLRLERQPNLMIREGMATD
FT                   VLVGSNDEVAGVRTFFGMEFRAPAVVLTTGTFMSGQIWVGRKTLAAGRAGEAPSEGLTE
FT                   SLCDLGFETDRLKTGTPARVDSRSIDYSLLEAQPGDEDERWFSFDPRAHVAREQMACHL
FT                   TRTTAATHQLIRDNLHETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRS
FT                   CPEVYVQGFSTGLPERLQLALLRTLPGLEKVNMLRPAYAVEYDFLPAYQCDNTLETKKI
FT                   RGLFFSGQINGTTGYEEAAAQGLLAGANAAAVALDGAKLVLPREGSYLGTLIDDLCTKD
FT                   LREPYRMLTSRSEYRLVLRSDNADQRLTPIGRECGLIDDERWGMFTDKMHAVEDELERL
FT                   KNTRVKSDSEVVQAILNAGAGGAKKPSRQSFTLEELLRRPEVDTAMLDGFGLGGGLTRW
FT                   DAEAVEVKVKYEGFIKRQEGQVAKVAGKMNKKIPEGIDYGAITTLRMEAREKLAKMTPR
FT                   TVGQASRIGGVTPADISSLLVHLEVGNRQKGVGKDARRAAKADRKAAVEAAEKERSETQ
FT                   SQSVAPPR"
     MSLANLARAS SGPGASVRRP ATVQRHAASL SGTAPAKASA SKIWRRRAPV LLGARAASRD        60
     DAGPTGTSPT SSVAGSNDAT GAAAASDARI PTYHLHEEEH DFDVIVVGAG HAGCEAALAA       120
     SRRGARTLLL TLSLDRIAWQ PCNPAVGGPA KSQLVHEVDA LGGEIGKMAD KCYLQKRVLN       180
     ASRGPAVWAL RAQTDKWEYS REMRLRLERQ PNLMIREGMA TDVLVGSNDE VAGVRTFFGM       240
     EFRAPAVVLT TGTFMSGQIW VGRKTLAAGR AGEAPSEGLT ESLCDLGFET DRLKTGTPAR       300
     VDSRSIDYSL LEAQPGDEDE RWFSFDPRAH VAREQMACHL TRTTAATHQL IRDNLHETPT       360
     YGGWVGAKGP RYCPSIEDKI VRFADKESHQ IFLEPEGRSC PEVYVQGFST GLPERLQLAL       420
     LRTLPGLEKV NMLRPAYAVE YDFLPAYQCD NTLETKKIRG LFFSGQINGT TGYEEAAAQG       480
     LLAGANAAAV ALDGAKLVLP REGSYLGTLI DDLCTKDLRE PYRMLTSRSE YRLVLRSDNA       540
     DQRLTPIGRE CGLIDDERWG MFTDKMHAVE DELERLKNTR VKSDSEVVQA ILNAGAGGAK       600
     KPSRQSFTLE ELLRRPEVDT AMLDGFGLGG GLTRWDAEAV EVKVKYEGFI KRQEGQVAKV       660
     AGKMNKKIPE GIDYGAITTL RMEAREKLAK MTPRTVGQAS RIGGVTPADI SSLLVHLEVG       720
     NRQKGVGKDA RRAAKADRKA AVEAAEKERS ETQSQSVAPP R                           761
//

If you have problems or comments...

PBIL Back to PBIL home page