(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE240

MICSR_1.PE240        Location/Qualifiers
FT   CDS             join(complement(476028..477390),complement(475970..475986))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636580"
FT                   /orf_name="MICPUN_56812"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62144.1"
FT                   /db_xref="HOGENOM:HBG560079"
FT                   /db_xref="UniParc:UPI000199ABB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B7"
FT                   /transl_table=1
FT                   /translation="MPPSRRSKGIRGWSLVIFVLAANVAYQGTRYLWRPTTGATPVSGH
FT                   QREKLEIRHRDDRRGGALLHHGHGASHGHGFHDAGVHRNDDDVEVIEEVVYEDVVVEDE
FT                   GHHGSSRGGASSGGGEGGGDPEPSGIHVMATSNGSPYQNWQTRIMYRTFLDAAKGSDMK
FT                   HFTRLLHRRTDDELMAEVPTVRVDSLHAECDRWCEFPVADRPDAIKKWLATADSRRGEW
FT                   ILMIEMDYVWKKAVPMPEPGSPAVAFHFNYINPNYPRLPEVMRSLMPPEKRDEIKMEDI
FT                   PCTGPAPTMIRRDDLVPLMDEYERIAAAIEADPVAKNRLGWVREMYAYDLAAAIAGVIH
FT                   VVQDPGETIMIAQPPADAKMGRASMYHYTWGAEYFKNGAKVWSWDKRPYVETKHVRQPA
FT                   KFKPELPPADGSEGVYNLQDGKKVSKGTDELLRDMLTLIRGAIDRLDELPHQPGCARKA
FT                   L"
     MPPSRRSKGI RGWSLVIFVL AANVAYQGTR YLWRPTTGAT PVSGHQREKL EIRHRDDRRG        60
     GALLHHGHGA SHGHGFHDAG VHRNDDDVEV IEEVVYEDVV VEDEGHHGSS RGGASSGGGE       120
     GGGDPEPSGI HVMATSNGSP YQNWQTRIMY RTFLDAAKGS DMKHFTRLLH RRTDDELMAE       180
     VPTVRVDSLH AECDRWCEFP VADRPDAIKK WLATADSRRG EWILMIEMDY VWKKAVPMPE       240
     PGSPAVAFHF NYINPNYPRL PEVMRSLMPP EKRDEIKMED IPCTGPAPTM IRRDDLVPLM       300
     DEYERIAAAI EADPVAKNRL GWVREMYAYD LAAAIAGVIH VVQDPGETIM IAQPPADAKM       360
     GRASMYHYTW GAEYFKNGAK VWSWDKRPYV ETKHVRQPAK FKPELPPADG SEGVYNLQDG       420
     KKVSKGTDEL LRDMLTLIRG AIDRLDELPH QPGCARKAL                              459
//

If you have problems or comments...

PBIL Back to PBIL home page