(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE242

MICSR_1.PE242        Location/Qualifiers
FT   CDS             join(489452..489505,489994..490830)
FT                   /codon_start=1
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636582"
FT                   /orf_name="MICPUN_107893"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="ACO61709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="HOGENOM:HBG292342"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199ABB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B9"
FT                   /transl_table=1
FT                   /translation="MATEAQKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAV
FT                   MALERVPADIRKDGGVARMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLESIGIDYI
FT                   DESEVLTPADEINHINKHNFKVPVLCGCRDLGEALRRIAEGSSMIRTKGEAGTGNVVEA
FT                   VRHCRAVMGDIRRLQSMDDDEIFVYAKEIRAPLELVKQTKTLGRLPVVNFAAGGVATPA
FT                   DAALMMQLGMDGVFVGSGIFKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGI
FT                   DCKEMHFTSYAARSE"
     MATEAQKGTF AVKVGLAQML KGGVIMDVVN VEQARIAEEA GAVAVMALER VPADIRKDGG        60
     VARMSDPTMI KAIKEAVTIP VMAKARIGHF VEAQVLESIG IDYIDESEVL TPADEINHIN       120
     KHNFKVPVLC GCRDLGEALR RIAEGSSMIR TKGEAGTGNV VEAVRHCRAV MGDIRRLQSM       180
     DDDEIFVYAK EIRAPLELVK QTKTLGRLPV VNFAAGGVAT PADAALMMQL GMDGVFVGSG       240
     IFKSGDPAKR ARAIVQAVTH YNDPKIIAEV SQGLGEAMVG IDCKEMHFTS YAARSE           296
//

If you have problems or comments...

PBIL Back to PBIL home page