(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE243

MICSR_1.PE243        Location/Qualifiers
FT   CDS             join(491157..491222,491319..492827)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636583"
FT                   /orf_name="MICPUN_56816"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61710.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ABBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C0"
FT                   /transl_table=1
FT                   /translation="MTVIPDTEDKVINAELSYAGLEITGLTEESIAAKRAATELRDALA
FT                   VSYSFKNICKIQYLGAFEKLTKLKLDNNFITRIENLDHLVHLQQLNLSFNRITKIEGLN
FT                   ALTKLKDLSLFNNEIQKVEGLDAQVATLEHLSLGNNKLDSLIDAFAGLRPFHGLRILTL
FT                   QGNPIHDDPDYKLYALGRLPWLKYLDHRRTKQDELEKARDLYVDEILEIEDRENDQRLK
FT                   AEDAAKAEAKRVKIEASNLTGVPDLFERMLAADPEYEKLRYIPNKEAPELCNGLELFKD
FT                   KYQQRCEAFTELMDDQLERKKNERAEWQAVVDGELRQKDVEAREWVTEFETLKKHALRD
FT                   CDKSEAGVTPELESRLRDLLDKSEELYNKLMAQEQWTAVVIDDLVTNYDLQLGEIVDES
FT                   KKHVMDYFEYARGLEETYFDGFNEAVGSVLMRLGQDELDEADEEVKDFLGDKDRFMNSC
FT                   QNHHDSHVNTIDTAEETMSKEEKRRHEAEVEELREWQATRNRGRVAEMLAMRKRYRGEI
FT                   EEYLEGE"
     MTVIPDTEDK VINAELSYAG LEITGLTEES IAAKRAATEL RDALAVSYSF KNICKIQYLG        60
     AFEKLTKLKL DNNFITRIEN LDHLVHLQQL NLSFNRITKI EGLNALTKLK DLSLFNNEIQ       120
     KVEGLDAQVA TLEHLSLGNN KLDSLIDAFA GLRPFHGLRI LTLQGNPIHD DPDYKLYALG       180
     RLPWLKYLDH RRTKQDELEK ARDLYVDEIL EIEDRENDQR LKAEDAAKAE AKRVKIEASN       240
     LTGVPDLFER MLAADPEYEK LRYIPNKEAP ELCNGLELFK DKYQQRCEAF TELMDDQLER       300
     KKNERAEWQA VVDGELRQKD VEAREWVTEF ETLKKHALRD CDKSEAGVTP ELESRLRDLL       360
     DKSEELYNKL MAQEQWTAVV IDDLVTNYDL QLGEIVDESK KHVMDYFEYA RGLEETYFDG       420
     FNEAVGSVLM RLGQDELDEA DEEVKDFLGD KDRFMNSCQN HHDSHVNTID TAEETMSKEE       480
     KRRHEAEVEE LREWQATRNR GRVAEMLAMR KRYRGEIEEY LEGE                        524
//

If you have problems or comments...

PBIL Back to PBIL home page