(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE244

MICSR_1.PE244        Location/Qualifiers
FT   CDS             complement(492895..494346)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636584"
FT                   /orf_name="MICPUN_56817"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62146.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199ABBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C1"
FT                   /transl_table=1
FT                   /translation="MGSSVNAEKKAKKEKKDKKDTKDKKEAKSDAGKKDASKKTAAAAA
FT                   QPMGKAAKKKALLDWFHGALKGDTDGARADFLKARDYVAVANVIRKHARDPKLKGAHAD
FT                   AIKLLDNKGHFLNIVDVVVKDGAADASTHWDKIKAHHRAKFEKAGGKDGVAEKKRAARE
FT                   AKEAFKVLQKERAEREAKQKELAADRKEYRQKMDEVRLKGACLDWCNLGKCKFGDECQF
FT                   KHPDELKGTLVALANKIKAKDVGGKKGKEREETERRKKRKAAKKEKERDGEGGGDSDSD
FT                   ADDGGGGDSESEDSFDRAAQAEDEYDSEDFDSDLDVDVDKSTGAKTKRKKRKDKVLSVL
FT                   PGDDGSDSDGDDEDLPRMVRLRKQKQREEAEWAKAERAAKKAKQAKILEKVKAARAAKG
FT                   LEMPKRQGSRDRSGGRGGGGRGGGGGRGGRGGRGGRGGRGGRGGRGEKRSFDGQASGEK
FT                   RKKKPRHADGRHAKHAAAHAARTAA"
     MGSSVNAEKK AKKEKKDKKD TKDKKEAKSD AGKKDASKKT AAAAAQPMGK AAKKKALLDW        60
     FHGALKGDTD GARADFLKAR DYVAVANVIR KHARDPKLKG AHADAIKLLD NKGHFLNIVD       120
     VVVKDGAADA STHWDKIKAH HRAKFEKAGG KDGVAEKKRA AREAKEAFKV LQKERAEREA       180
     KQKELAADRK EYRQKMDEVR LKGACLDWCN LGKCKFGDEC QFKHPDELKG TLVALANKIK       240
     AKDVGGKKGK EREETERRKK RKAAKKEKER DGEGGGDSDS DADDGGGGDS ESEDSFDRAA       300
     QAEDEYDSED FDSDLDVDVD KSTGAKTKRK KRKDKVLSVL PGDDGSDSDG DDEDLPRMVR       360
     LRKQKQREEA EWAKAERAAK KAKQAKILEK VKAARAAKGL EMPKRQGSRD RSGGRGGGGR       420
     GGGGGRGGRG GRGGRGGRGG RGGRGEKRSF DGQASGEKRK KKPRHADGRH AKHAAAHAAR       480
     TAA                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page