(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE245

MICSR_1.PE245        Location/Qualifiers
FT   CDS             complement(494473..495027)
FT                   /codon_start=1
FT                   /gene_family="HOG000264638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636585"
FT                   /orf_name="MICPUN_99389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62147.1"
FT                   /db_xref="HOGENOM:HBG609069"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniParc:UPI000199ABBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C2"
FT                   /transl_table=1
FT                   /translation="MAIYVKAFSLVLKTVSKPLAKQVKEMAKSHPFLRELSISMALKAD
FT                   SLYQTIMSPTPLNEPIISSGGRRMKIPKKPPVMTEDQALQAAGDFLAEATVFGIAGGLV
FT                   WWEQSKSAEKDEKKAAAAKEEREQLTTMIALQQRTLQDVTEVLKEFEQHRRETSAALEE
FT                   MQRRARERDSRRWWGWAAAVS"
     MAIYVKAFSL VLKTVSKPLA KQVKEMAKSH PFLRELSISM ALKADSLYQT IMSPTPLNEP        60
     IISSGGRRMK IPKKPPVMTE DQALQAAGDF LAEATVFGIA GGLVWWEQSK SAEKDEKKAA       120
     AAKEEREQLT TMIALQQRTL QDVTEVLKEF EQHRRETSAA LEEMQRRARE RDSRRWWGWA       180
     AAVS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page