(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE247

MICSR_1.PE247        Location/Qualifiers
FT   CDS             complement(<499470..500141)
FT                   /codon_start=1
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636587"
FT                   /orf_name="MICPUN_72415"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62148.1"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199ABBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C4"
FT                   /transl_table=1
FT                   /translation="MAEGGKTSVSNYDLDGNSFRNTMHSLNYGNVMEAAARNYMKEVKA
FT                   EEAAAANVGPIQYDLEDLEDDPELHQLHKERIQQMKEEQEKRREMQRKGHGEYRDIDEG
FT                   EFLPEVTGSFQVCVHFYHQEFERCRIVDKHMAILAKKYFDTKFIKVHAPDCPFFVTKLN
FT                   VKVLPCIVFFRNGVAYDRIVGFEELGAKDDFPTSRLENMLLTAGIIAVPEKGEDDSEDE
FT                   EE"
     MAEGGKTSVS NYDLDGNSFR NTMHSLNYGN VMEAAARNYM KEVKAEEAAA ANVGPIQYDL        60
     EDLEDDPELH QLHKERIQQM KEEQEKRREM QRKGHGEYRD IDEGEFLPEV TGSFQVCVHF       120
     YHQEFERCRI VDKHMAILAK KYFDTKFIKV HAPDCPFFVT KLNVKVLPCI VFFRNGVAYD       180
     RIVGFEELGA KDDFPTSRLE NMLLTAGIIA VPEKGEDDSE DEEE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page