(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE248

MICSR_1.PE248        Location/Qualifiers
FT   CDS             500533..502227
FT                   /codon_start=1
FT                   /gene_family="HOG000264639" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636588"
FT                   /orf_name="MICPUN_56821"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ACO61712.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG560083"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI000199AC31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C5"
FT                   /transl_table=1
FT                   /translation="MSDVEAETAAEVEQEAGPSSPTAPPAYESIVLSDPEPAPAVSEIE
FT                   NNAAASGGNAYPSPPAQPPGARLVARVTEPVKIGDGMTAHAAYVVAVDTDMPVFRLPKL
FT                   SVQRRFSDFTWLRDKLRATFPGIILYPLPDKVVTTSPFNPEFLEHRRAGLDLFLRKTCE
FT                   HPALRESIDLVAFLQDEHGASLGSAASPWYQRGAAGTALAAADSWWQQITTATESFVAG
FT                   AGTESLLMEEDPKYLEATEYLLLLEERLRRAVRSSDDVVGAVNAGGIIVESFAENARVL
FT                   GDCEEKGAKVLLGDAAGGLGQAFRQVGAAAQTLRAPAETQAWRLADAFRAPLKRGLALV
FT                   QAAKEAIDARTDALLKLQTARARCEQKRARYEAVAGGGSNGVNGAAGAPPPVAPAPPPT
FT                   LGSTWMSSLSSITKGAFGGGAAQPSVEELQKEAESAATAKDVAQSRYDALKDRMTTELP
FT                   RLHGELESELNAAFACAAECFKDLAAAQAAAWESVVPGCSDVEPAAPPPLPEKGTDGAT
FT                   EGRVKALWTQYMGGSTTNGGGSSGGSAAAAAAAAAAEGSSPTGVLPE"
     MSDVEAETAA EVEQEAGPSS PTAPPAYESI VLSDPEPAPA VSEIENNAAA SGGNAYPSPP        60
     AQPPGARLVA RVTEPVKIGD GMTAHAAYVV AVDTDMPVFR LPKLSVQRRF SDFTWLRDKL       120
     RATFPGIILY PLPDKVVTTS PFNPEFLEHR RAGLDLFLRK TCEHPALRES IDLVAFLQDE       180
     HGASLGSAAS PWYQRGAAGT ALAAADSWWQ QITTATESFV AGAGTESLLM EEDPKYLEAT       240
     EYLLLLEERL RRAVRSSDDV VGAVNAGGII VESFAENARV LGDCEEKGAK VLLGDAAGGL       300
     GQAFRQVGAA AQTLRAPAET QAWRLADAFR APLKRGLALV QAAKEAIDAR TDALLKLQTA       360
     RARCEQKRAR YEAVAGGGSN GVNGAAGAPP PVAPAPPPTL GSTWMSSLSS ITKGAFGGGA       420
     AQPSVEELQK EAESAATAKD VAQSRYDALK DRMTTELPRL HGELESELNA AFACAAECFK       480
     DLAAAQAAAW ESVVPGCSDV EPAAPPPLPE KGTDGATEGR VKALWTQYMG GSTTNGGGSS       540
     GGSAAAAAAA AAAEGSSPTG VLPE                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page