(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE249

MICSR_1.PE249        Location/Qualifiers
FT   CDS             complement(502473..503750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636589"
FT                   /orf_name="MICPUN_56822"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62149.1"
FT                   /db_xref="UniParc:UPI000199AC32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C6"
FT                   /transl_table=1
FT                   /translation="MSTISTAPARWCRSVRASPGRSLRHAANCFALGSAAFVLRFTALA
FT                   DADATTAMAATPDHLSTAALARDVVDLASASLYTLGSTLWLHQTVLRERLRGSTQSPAA
FT                   VADSMDEQSATRWSQPPTWNEIAELVSGNPVVCSVVLFLCGCALDDALSLSDVIAEEVA
FT                   TRARGGLSNGEIWPPSLDPRQPAQPARISFELVLPFAPGVVGAVAFGVGGAARLVRLVR
FT                   GDGDSFDTRDEANMWLPCERDDECASMVPPPEVTERLDARIANVARFAQWPLNLLASFA
FT                   FIDGAWLAEFGAWSKLAGAQPASGNVLASVGGDVINVASSLSESAARLASENYVVGNSL
FT                   ADLGSIRDDLFGGRNGSPGDATAADGLATGAHRALSSSDAAHALGGGLFLVSSVAWIVE
FT                   LRARRRLRCARRGDDGDGHGDGDGDA"
     MSTISTAPAR WCRSVRASPG RSLRHAANCF ALGSAAFVLR FTALADADAT TAMAATPDHL        60
     STAALARDVV DLASASLYTL GSTLWLHQTV LRERLRGSTQ SPAAVADSMD EQSATRWSQP       120
     PTWNEIAELV SGNPVVCSVV LFLCGCALDD ALSLSDVIAE EVATRARGGL SNGEIWPPSL       180
     DPRQPAQPAR ISFELVLPFA PGVVGAVAFG VGGAARLVRL VRGDGDSFDT RDEANMWLPC       240
     ERDDECASMV PPPEVTERLD ARIANVARFA QWPLNLLASF AFIDGAWLAE FGAWSKLAGA       300
     QPASGNVLAS VGGDVINVAS SLSESAARLA SENYVVGNSL ADLGSIRDDL FGGRNGSPGD       360
     ATAADGLATG AHRALSSSDA AHALGGGLFL VSSVAWIVEL RARRRLRCAR RGDDGDGHGD       420
     GDGDA                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page