(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE250

MICSR_1.PE250        Location/Qualifiers
FT   CDS             504300..504959
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636590"
FT                   /orf_name="MICPUN_56823"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61713.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AC33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C7"
FT                   /transl_table=1
FT                   /translation="MRYFMRYLLACSAGESSVGEGRAAERAESTRKTPPTMMTTRVLLA
FT                   PTTRSSIAVGKGKAFANDSTSRGATRVVTTALPSTASRAKITISGGALALALAFTPPAL
FT                   AALDPYGGVGLEIYVGPDRLPAIVEFLPTKTTGPAHDAGLRLNDKILEVNGVAATELGG
FT                   LQGVAKALRGEAGTDVDVTVGRGRGRAPLAVEKVRMKREEIAPNPRSCFVASCARV"
     MRYFMRYLLA CSAGESSVGE GRAAERAEST RKTPPTMMTT RVLLAPTTRS SIAVGKGKAF        60
     ANDSTSRGAT RVVTTALPST ASRAKITISG GALALALAFT PPALAALDPY GGVGLEIYVG       120
     PDRLPAIVEF LPTKTTGPAH DAGLRLNDKI LEVNGVAATE LGGLQGVAKA LRGEAGTDVD       180
     VTVGRGRGRA PLAVEKVRMK REEIAPNPRS CFVASCARV                              219
//

If you have problems or comments...

PBIL Back to PBIL home page