(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE251

MICSR_1.PE251        Location/Qualifiers
FT   CDS             complement(505082..505972)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636591"
FT                   /orf_name="MICPUN_107894"
FT                   /product="Predicted protein"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62150.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI000199AC34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C8"
FT                   /transl_table=1
FT                   /translation="MKHKNSLLGEGVTSPPELSKRVFVPLCGKAVDMLWLASCGHRVYG
FT                   VDLSGVAARDFFDEAGLPRTTTPADAMVAERWSAGVKRVHTSGNIAIVEGDLFSIRPDP
FT                   DPRPDEDDARSYGWFGVMPRVDSGGSIIARSSSNIANEDGPDTSSALDARVGAQGSISF
FT                   REEALRFASGGGPAMDAVWDRGALVAVEPSLRDRYASALVARLAPGGRMLVVSLSYDPN
FT                   AGCAGPPHNVPHEELVRLYESRGCEVTLLGSEEVIESAPPRMREKISSMTESAYLVRKP
FT                   HRRGKGGFHLPRPRL"
     MKHKNSLLGE GVTSPPELSK RVFVPLCGKA VDMLWLASCG HRVYGVDLSG VAARDFFDEA        60
     GLPRTTTPAD AMVAERWSAG VKRVHTSGNI AIVEGDLFSI RPDPDPRPDE DDARSYGWFG       120
     VMPRVDSGGS IIARSSSNIA NEDGPDTSSA LDARVGAQGS ISFREEALRF ASGGGPAMDA       180
     VWDRGALVAV EPSLRDRYAS ALVARLAPGG RMLVVSLSYD PNAGCAGPPH NVPHEELVRL       240
     YESRGCEVTL LGSEEVIESA PPRMREKISS MTESAYLVRK PHRRGKGGFH LPRPRL           296
//

If you have problems or comments...

PBIL Back to PBIL home page