(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE252

MICSR_1.PE252        Location/Qualifiers
FT   CDS             507274..508422
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636592"
FT                   /orf_name="MICPUN_107895"
FT                   /product="Predicted protein"
FT                   /function="cobalt ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors, iron-sulfur protein as acceptor "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="phytochromobilin biosynthetic process "
FT                   /protein_id="ACO61714.1"
FT                   /db_xref="GO:0010024"
FT                   /db_xref="GO:0016636"
FT                   /db_xref="GO:0050897"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="UniParc:UPI000199AC35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C9"
FT                   /transl_table=1
FT                   /translation="MEFLFRTLDRSLGPLTPVHLPPELASASVPGKVRSETWVYTSPFV
FT                   RRARFTYVDGGEKTQIFNCVVYPRCVDDSTGEESHLGDAPLLGVDLLSLNGGKKILVGV
FT                   DLQPLSRSEAYLGRYVDALASLRDARFAELNLVEPSDRFYEDAQFFSPAMLFARPVPVD
FT                   VAVDCAVAAAKATGALQDLGTITAEDVCGVEWAEPNSGCGVPLVEAKTLDAVKAYAAKW
FT                   LELMDARNDDWAKAWDQGGRAGGGATSALGSRAGSFSQMLANNIKSAVGAKSEGGEDEP
FT                   AAEAADAAEGDPPAPPAEKTEEPKRAAEVRAGKYARVLTAAESAAAQDFHDMWQRSHDP
FT                   AIPMFAGWFGKEWAERLASEVLFPEDKAKEELKAWEAQQRGG"
     MEFLFRTLDR SLGPLTPVHL PPELASASVP GKVRSETWVY TSPFVRRARF TYVDGGEKTQ        60
     IFNCVVYPRC VDDSTGEESH LGDAPLLGVD LLSLNGGKKI LVGVDLQPLS RSEAYLGRYV       120
     DALASLRDAR FAELNLVEPS DRFYEDAQFF SPAMLFARPV PVDVAVDCAV AAAKATGALQ       180
     DLGTITAEDV CGVEWAEPNS GCGVPLVEAK TLDAVKAYAA KWLELMDARN DDWAKAWDQG       240
     GRAGGGATSA LGSRAGSFSQ MLANNIKSAV GAKSEGGEDE PAAEAADAAE GDPPAPPAEK       300
     TEEPKRAAEV RAGKYARVLT AAESAAAQDF HDMWQRSHDP AIPMFAGWFG KEWAERLASE       360
     VLFPEDKAKE ELKAWEAQQR GG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page