(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE253

MICSR_1.PE253        Location/Qualifiers
FT   CDS             join(508566..508691,508806..509182,509597..509891,
FT                   509946..510212)
FT                   /codon_start=1
FT                   /gene_family="HOG000030046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636593"
FT                   /orf_name="MICPUN_80230"
FT                   /product="Predicted protein"
FT                   /biological_process="protein modification process "
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO61715.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG560088"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI000199AC36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D0"
FT                   /transl_table=1
FT                   /translation="MPVSAQVQYYLNAKLTATGASALPYDERLKFAVRDQLLAVVERYP
FT                   SLSVRDDPFTHNDGRTVHLLRAEGTIPIYYMGVKYNIPLKMFLPEAFPHAQPICYVTPT
FT                   SNMIIKPGHSCVDGSGLVRSPYGDRWSYPRSNLTELAGLLSEAFGSEPPLFAKPAGYVP
FT                   PPPRTSPHVLAGGLSVAEGTFKARAITALSDRLRSELDVLRAQSGEEAERLLTLQAELA
FT                   RRREDIERSLREMRAERGAWEHRIGGMQAATVALEEWVSENEGKRKETEIADAAFRPED
FT                   PLSEQILEEMAKDLALEDAMDCLDEALSAKQIELEPYLELIRELSKEQFFARATTMVAR
FT                   KEQRERGVSQGVTF"
     MPVSAQVQYY LNAKLTATGA SALPYDERLK FAVRDQLLAV VERYPSLSVR DDPFTHNDGR        60
     TVHLLRAEGT IPIYYMGVKY NIPLKMFLPE AFPHAQPICY VTPTSNMIIK PGHSCVDGSG       120
     LVRSPYGDRW SYPRSNLTEL AGLLSEAFGS EPPLFAKPAG YVPPPPRTSP HVLAGGLSVA       180
     EGTFKARAIT ALSDRLRSEL DVLRAQSGEE AERLLTLQAE LARRREDIER SLREMRAERG       240
     AWEHRIGGMQ AATVALEEWV SENEGKRKET EIADAAFRPE DPLSEQILEE MAKDLALEDA       300
     MDCLDEALSA KQIELEPYLE LIRELSKEQF FARATTMVAR KEQRERGVSQ GVTF             354
//

If you have problems or comments...

PBIL Back to PBIL home page