(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE255

MICSR_1.PE255        Location/Qualifiers
FT   CDS             <512146..>512826
FT                   /codon_start=1
FT                   /gene_family="HOG000184445" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636595"
FT                   /orf_name="MICPUN_71958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61716.1"
FT                   /db_xref="HOGENOM:HBG316414"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199AC38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D2"
FT                   /transl_table=1
FT                   /translation="HVVYRGPEGETTVWDDVQRRFGNKPPLPEKFVPRAYAPEEDRGLR
FT                   AAVERDGRAGGVAHVDAAGGTDALEAMEDEDAFADDGFLEEYRRKRLEEMKTAAAIPRF
FT                   GAVVEITRDSFMAHVTDPSSEHYVLVLLHRPNCPECELLNVAYRELARKHPFTKFTSIP
FT                   GKECIPGYPDRNMPTLLVYRNRDPVRTFMGLGHFGGRHMTPEGLELALNECGRVCAGAR
FT                   GGEDE"
     HVVYRGPEGE TTVWDDVQRR FGNKPPLPEK FVPRAYAPEE DRGLRAAVER DGRAGGVAHV        60
     DAAGGTDALE AMEDEDAFAD DGFLEEYRRK RLEEMKTAAA IPRFGAVVEI TRDSFMAHVT       120
     DPSSEHYVLV LLHRPNCPEC ELLNVAYREL ARKHPFTKFT SIPGKECIPG YPDRNMPTLL       180
     VYRNRDPVRT FMGLGHFGGR HMTPEGLELA LNECGRVCAG ARGGEDE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page