(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE256

MICSR_1.PE256        Location/Qualifiers
FT   CDS             complement(513056..514030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636596"
FT                   /orf_name="MICPUN_56829"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62152.1"
FT                   /db_xref="InterPro:IPR019132"
FT                   /db_xref="UniParc:UPI000199AC39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D3"
FT                   /transl_table=1
FT                   /translation="MGGKAKGKTSGTEGTAPTASNPAEDALNSVLDGLDTPEEKLAALS
FT                   AKFLELHKDLRRTSRRCDEAEGKVGMALVERDAARQELTKNAEVNDKLQALCRTLQGAN
FT                   KETSALLREREEAQLKLREDLEAKFDEGLGAVSKRIEESASVRDDLLKENDTLRDHLKK
FT                   LVARGDLQQETYAKAKDAFDLEKQLLEARLAEAVAFNDQLTAKLQQREEESKGYLEQLS
FT                   GYADKFDTFQGVISQSNETFTQFKTDIADLSKKLIESEAAKREMEAKTLKSDVAMIKLL
FT                   EEREQLTAQCVSLKAKKDKLEGLCRALQKQTISGDKENAKAAA"
     MGGKAKGKTS GTEGTAPTAS NPAEDALNSV LDGLDTPEEK LAALSAKFLE LHKDLRRTSR        60
     RCDEAEGKVG MALVERDAAR QELTKNAEVN DKLQALCRTL QGANKETSAL LREREEAQLK       120
     LREDLEAKFD EGLGAVSKRI EESASVRDDL LKENDTLRDH LKKLVARGDL QQETYAKAKD       180
     AFDLEKQLLE ARLAEAVAFN DQLTAKLQQR EEESKGYLEQ LSGYADKFDT FQGVISQSNE       240
     TFTQFKTDIA DLSKKLIESE AAKREMEAKT LKSDVAMIKL LEEREQLTAQ CVSLKAKKDK       300
     LEGLCRALQK QTISGDKENA KAAA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page